Products

cDNA Clones (152)
Proteins (49)
RNAi (8)
Primary Antibodies (7)
Gene Expression (6)
Jump to Filters
View as table Download
TCF7L2 Rabbit Polyclonal Antibody
TA333645

USD 375.00

In Stock

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
TCF7L2 Rabbit Polyclonal Antibody
TA336734

USD 424.00

5 Days

Rabbit Polyclonal TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human TCF7L2 (within residues 150-200). [Swiss-Prot# Q9NQB0]
TCF7L2 (N-term) Rabbit Polyclonal Antibody
AP54203PU-N

USD 450.00

2 Weeks

TCF7L2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 60-90 amino acids from the N-terminal region of human TCF7L2
TCF7L2 Rabbit Polyclonal Antibody
TA333646

USD 375.00

5 Days

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the middle region of human TCF7L2. Synthetic peptide located within the following region: GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
TCF7L2 Rabbit Polyclonal Antibody
TA356048

USD 360.00

5 Days

TCF7L2 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L2
TCF7L2 Rabbit Polyclonal Antibody
TA385382

USD 380.00

4 Weeks

Transcription Factor 7 Like 2 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human TCF7L2
TCF7L2 Rabbit Monoclonal Antibody [Clone ID: R09-1D1]
TA385383

USD 380.00

4 Weeks

Transcription Factor 7 Like 2 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated