Products

View as table Download

Abca2 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 2 (Abca2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA2 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 2 (ABCA2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA2 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 2 (ABCA2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA2 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 2 (ABCA2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA2 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 2 (ABCA2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN416007 is the updated version of KN216007.

Abca2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN500603 is the updated version of KN300603.

Abca2 (GFP-tagged) - Mouse ATP-binding cassette sub-family A (ABC1) member 2 (Abca2), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Abca2 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family A (ABC1), member 2 (Abca2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCA2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Rabbit Polyclonal Anti-ABCA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ABCA2. Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS

ABCA2 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily A member 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Abca2 CRISPRa kit - CRISPR gene activation of mouse ATP-binding cassette, sub-family A (ABC1), member 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qSTAR qPCR primer pairs against Homo sapiens gene ABCA2

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

Abca2 (untagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 2 (Abca2), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Abca2

Abca2 (untagged ORF) - Rat ATP-binding cassette, sub-family A (ABC1), member 2 (Abca2), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of ATP-binding cassette sub-family A (ABC1) member 2 (ABCA2) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

3`UTR clone of ATP-binding cassette sub-family A (ABC1) member 2 (ABCA2) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

ABCA2 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 2 (ABCA2), transcript variant 1

Vector pCMV6 series
Tag Tag Free

ABCA2 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 2 (ABCA2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Abca2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Abca2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Anti-ABCA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 113-127 amino acids of human ATP-binding cassette, sub-family A (ABC1), member 2

ABCA2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2307-2466 of human ABCA2 (NP_997698.1).
Modifications Unmodified

USD 2,649.00

4 Weeks

Transient overexpression of ABCA2 (NM_212533) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 2,649.00

4 Weeks

Transient overexpression of ABCA2 (NM_001606) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ABCA2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

ABCA2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Abca2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Abca2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Abca2 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Abca2 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

ABCA2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin

Abca2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Abca2 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

USD 225.00

4 Weeks

Transient overexpression of ABCA2 (NM_212533) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ABCA2 (NM_212533) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of ABCA2 (NM_001606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ABCA2 (NM_001606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack