Products

cDNA Clones (39)
Proteins (12)
RNAi (11)
Antibodies (9)
Gene Expression (6)
Jump to Filters
View as table Download
AGAP1 (NM_014914) Human Tagged ORF Clone
RC214836

USD 610.00

In Stock

AGAP1 (Myc-DDK-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AGAP1 (NM_001037131) Human Tagged ORF Clone
RC221341

USD 420.00

In Stock

AGAP1 (Myc-DDK-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Agap1 (NM_001037136) Mouse Tagged ORF Clone
MR227528

USD 750.00

In Stock

Agap1 (Myc-DDK-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AGAP1 (NM_014914) Human Tagged ORF Clone
RG214836

USD 670.00

In Stock

AGAP1 (GFP-tagged) - Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AGAP1 Human Gene Knockout Kit (CRISPR)
KN414836

USD 1,290.00

2 Weeks

AGAP1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN414836 is the updated version of KN214836.
Agap1 Mouse Gene Knockout Kit (CRISPR)
KN500966

USD 1,290.00

2 Weeks

Agap1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN500966 is the updated version of KN300966.
Agap1 (NM_178119) Mouse Tagged ORF Clone
MG227525

USD 990.00

3 Weeks

Agap1 (GFP-tagged) - Mouse ArfGAP with GTPase domain ankyrin repeat and PH domain 1 (Agap1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Agap1 (NM_001037136) Mouse Tagged ORF Clone
MG227528

USD 830.00

3 Weeks

Agap1 (GFP-tagged) - Mouse ArfGAP with GTPase domain ankyrin repeat and PH domain 1 (Agap1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Agap1 (NM_178119) Mouse Tagged ORF Clone
MR227525

USD 900.00

5 Weeks

Agap1 (Myc-DDK-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Agap1 (NM_178119) Mouse Tagged ORF Clone
MR227525L3

USD 1,100.00

5 Weeks

Lenti ORF clone of Agap1 (Myc-DDK-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_178119) Mouse Tagged ORF Clone Lentiviral Particle
MR227525L3V

USD 1,300.00

8 Weeks

Lenti ORF particles, Agap1 (Myc-DDK-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_178119) Mouse Tagged ORF Clone
MR227525L4

USD 1,100.00

5 Weeks

Lenti ORF clone of Agap1 (mGFP-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_178119) Mouse Tagged ORF Clone Lentiviral Particle
MR227525L4V

USD 1,300.00

8 Weeks

Lenti ORF particles, Agap1 (GFP-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_001037136) Mouse Tagged ORF Clone
MR227528L3

USD 950.00

3 Weeks

Lenti ORF clone of Agap1 (Myc-DDK-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_001037136) Mouse Tagged ORF Clone Lentiviral Particle
MR227528L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, Agap1 (Myc-DDK-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_001037136) Mouse Tagged ORF Clone
MR227528L4

USD 950.00

3 Weeks

Lenti ORF clone of Agap1 (mGFP-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_001037136) Mouse Tagged ORF Clone Lentiviral Particle
MR227528L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, Agap1 (GFP-tagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_014914) Human Tagged ORF Clone
RC214836L3

USD 810.00

3 Weeks

Lenti-ORF clone of AGAP1 (Myc-DDK-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_014914) Human Tagged ORF Clone Lentiviral Particle
RC214836L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, AGAP1 (Myc-DDK-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_014914) Human Tagged ORF Clone
RC214836L4

USD 810.00

3 Weeks

Lenti-ORF clone of AGAP1 (mGFP-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_014914) Human Tagged ORF Clone Lentiviral Particle
RC214836L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, AGAP1 (mGFP-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_001037131) Human Tagged ORF Clone
RC221341L3

USD 620.00

3 Weeks

Lenti-ORF clone of AGAP1 (Myc-DDK-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_001037131) Human Tagged ORF Clone Lentiviral Particle
RC221341L3V

USD 820.00

6 Weeks

Lenti ORF particles, AGAP1 (Myc-DDK-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_001037131) Human Tagged ORF Clone
RC221341L4

USD 620.00

3 Weeks

Lenti-ORF clone of AGAP1 (mGFP-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_001037131) Human Tagged ORF Clone Lentiviral Particle
RC221341L4V

USD 820.00

6 Weeks

Lenti ORF particles, AGAP1 (mGFP-tagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 (NM_001244888) Human Tagged ORF Clone
RC234002

USD 420.00

5 Weeks

AGAP1 (Myc-DDK tagged) - Homo sapiens ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AGAP1 (NM_001037131) Human Tagged ORF Clone
RG221341

USD 460.00

3 Weeks

AGAP1 (GFP-tagged) - Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AGAP1 (NM_001244888) Human Tagged ORF Clone
RG234002

USD 460.00

5 Weeks

AGAP1 (GFP-tagged) - Homo sapiens ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Agap1 (NM_001108230) Rat Tagged ORF Clone
RR204908

USD 910.00

5 Weeks

Agap1 (Myc-DDK-tagged ORF) - Rat centaurin, gamma 2 (Centg2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Agap1 (NM_001108230) Rat Tagged ORF Clone
RR204908L3

USD 1,100.00

10 Weeks

Lenti ORF clone of Agap1 (Myc-DDK-tagged ORF) - Rat centaurin, gamma 2 (Centg2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Agap1 (NM_001108230) Rat Tagged ORF Clone
RR204908L4

USD 1,210.00

10 Weeks

Lenti ORF clone of Agap1 (mGFP-tagged ORF) - Rat centaurin, gamma 2 (Centg2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AGAP1 Human qPCR Primer Pair (NM_001037131)
HP203138

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene AGAP1

AGAP1 (NM_014914) Human Over-expression Lysate
LC402388

USD 187.00

In Stock

AGAP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AGAP1 (NM_014914) Human Over-expression Lysate
LY402388

USD 605.00

5 Days

Transient overexpression lysate of ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AGAP1 (NM_014914) Human Untagged Clone
SC127122

USD 760.00

In Stock

AGAP1 (untagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
AGAP1 Rabbit Polyclonal Antibody
TA308588

USD 415.00

5 Days

Rabbit polyclonal antibody to CENTG2 (centaurin, gamma 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 795 and 857 of AGAP1 (Uniprot ID#Q9UPQ3)
Agap1 Mouse qPCR Primer Pair (NM_178119)
MP202297

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Agap1

AGAP1 Rabbit Polyclonal Antibody
TA343187

USD 375.00

5 Days

Rabbit Polyclonal Anti-AGAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGAP1 antibody is: synthetic peptide directed towards the middle region of Human AGAP1. Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG
AGAP1 Mouse Monoclonal Antibody [Clone ID: OTI4E8]
CF504204

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human AGAP1 activation kit by CRISPRa
GA114622

USD 1,290.00

2 Weeks

AGAP1 CRISPRa kit - CRISPR gene activation of human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Agap1 activation kit by CRISPRa
GA216950

USD 1,290.00

2 Weeks

Agap1 CRISPRa kit - CRISPR gene activation of mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Agap1 (NM_001037136) Mouse Untagged Clone
MC221789

USD 1,090.00

5 Weeks

Agap1 (untagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Agap1 (NM_178119) Mouse Untagged Clone
MC222206

USD 1,150.00

5 Weeks

Agap1 (untagged) - Mouse ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (Agap1), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AGAP1 (NM_014914) Human Mass Spec Standard
PH314836

USD 2,055.00

3 Weeks

AGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055729)

Tag C-Myc/DDK
Expression Host HEK293
Agap1 (NM_001108230) Rat Untagged Clone
RN204908

USD 910.00

6 Weeks

Agap1 (untagged ORF) - Rat centaurin, gamma 2 (Centg2), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AGAP1 (NM_001037131) Human 3' UTR Clone
SC214150

USD 560.00

4 Weeks

3`UTR clone of ArfGAP with GTPase domain ankyrin repeat and PH domain 1 (AGAP1) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
AGAP1 (NM_014914) Human 3' UTR Clone
SC214151

USD 560.00

4 Weeks

3`UTR clone of ArfGAP with GTPase domain ankyrin repeat and PH domain 1 (AGAP1) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
AGAP1 (NM_001037131) Human Untagged Clone
SC302850

USD 760.00

5 Weeks

AGAP1 (untagged)-Human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 1

Vector pCMV6 series
Tag Tag Free