Germany
Japan
United Kingdom
China
AHR (untagged)-Human aryl hydrocarbon receptor (AHR)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadAHR (Myc-DDK-tagged)-Human aryl hydrocarbon receptor (AHR)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
AHR (GFP-tagged) - Human aryl hydrocarbon receptor (AHR)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ahr (Myc-DDK-tagged) - Mouse aryl-hydrocarbon receptor (Ahr)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHR - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Ahr (Myc-DDK-tagged) - Mouse aryl-hydrocarbon receptor (Ahr), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Ahr (GFP-tagged) - Mouse aryl-hydrocarbon receptor (Ahr), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 1,150.00
3 Weeks
Lenti ORF particles, AHR (Myc-DDK tagged) - Human aryl hydrocarbon receptor (AHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,150.00
3 Weeks
Lenti ORF particles, AHR (mGFP-tagged) - Human aryl hydrocarbon receptor (AHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Ahr (GFP-tagged) - Mouse aryl-hydrocarbon receptor (Ahr), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,150.00
3 Weeks
Lenti ORF particles, AHR (Myc-DDK tagged) - Human aryl hydrocarbon receptor (AHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ahr (Myc-DDK-tagged ORF) - Rat aryl hydrocarbon receptor (Ahr), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ahr - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501012 is the updated version of KN301012.
Lenti ORF particles, Ahr (GFP-tagged) - Mouse aryl-hydrocarbon receptor (Ahr), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,150.00
3 Weeks
Lenti ORF particles, AHR (mGFP-tagged) - Human aryl hydrocarbon receptor (AHR), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Ahr (GFP-tagged ORF) - Rat aryl hydrocarbon receptor (Ahr), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ahr (Myc-DDK-tagged) - Mouse aryl-hydrocarbon receptor (Ahr)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ahr (Myc-DDK-tagged) - Mouse aryl-hydrocarbon receptor (Ahr), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aryl hydrocarbon receptor (AHR), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human aryl hydrocarbon receptor (AHR), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Ahr (Myc-DDK-tagged ORF) - Rat aryl hydrocarbon receptor (Ahr), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ahr (Myc-DDK-tagged ORF) - Rat aryl hydrocarbon receptor (Ahr), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,617.00
2 Weeks
AHR - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
AHR - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
USD 396.00
In Stock
Transient overexpression lysate of aryl hydrocarbon receptor (AHR)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
AHR - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Ahr (Myc-DDK-tagged) - Mouse aryl-hydrocarbon receptor (Ahr)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
AHR (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR319302 is the updated version of SR300136.
Lenti ORF clone of Ahr (mGFP-tagged) - Mouse aryl-hydrocarbon receptor (Ahr)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Ahr (mGFP-tagged ORF) - Rat aryl hydrocarbon receptor (Ahr), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal AhR (Ser36) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR around the phosphorylation site of Serine 36 |
| Modifications | Phospho-specific |
Ahr - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Ahr (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit polyclonal AhR (Ser36) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal AhR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR |
Ahr - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Aryl hydrocarbon Receptor (AHR) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 121.00
In Stock
AHR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Ahr (untagged) - Mouse aryl-hydrocarbon receptor (Ahr), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Ahr (mGFP-tagged) - Mouse aryl-hydrocarbon receptor (Ahr)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Ahr (untagged ORF) - Rat aryl hydrocarbon receptor (Ahr), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ahr (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ahr - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 480.00
2 Weeks
qSTAR qPCR primer pairs against Mus musculus gene Ahr
Rabbit Polyclonal Anti-AHR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL |
Goat Polyclonal AHR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | N-terminal sequence of Aryl hydrocarbon Receptor purified from C57BL/6J mice. [UniProt# P30561] |
Active filters
Target Symbol
- AHR