Germany
Japan
United Kingdom
China
CCDC12 (Myc-DDK-tagged)-Human coiled-coil domain containing 12 (CCDC12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human coiled-coil domain containing 12 (CCDC12)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Ccdc12 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 12 (Ccdc12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CCDC12 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405023 is the updated version of KN205023.
Ccdc12 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502643 is the updated version of KN302643.
Ccdc12 (GFP-tagged) - Mouse coiled-coil domain containing 12 (Ccdc12)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ccdc12 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 12 (Ccdc12)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ccdc12 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 12 (Ccdc12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ccdc12 (mGFP-tagged) - Mouse coiled-coil domain containing 12 (Ccdc12)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ccdc12 (GFP-tagged) - Mouse coiled-coil domain containing 12 (Ccdc12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human coiled-coil domain containing 12 (CCDC12), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CCDC12 (Myc-DDK tagged) - Human coiled-coil domain containing 12 (CCDC12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human coiled-coil domain containing 12 (CCDC12), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CCDC12 (mGFP-tagged) - Human coiled-coil domain containing 12 (CCDC12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CCDC12 (Myc-DDK tagged) - Homo sapiens coiled-coil domain containing 12 (CCDC12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CCDC12 (GFP-tagged) - Human coiled-coil domain containing 12 (CCDC12)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CCDC12 (GFP-tagged) - Homo sapiens coiled-coil domain containing 12 (CCDC12), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ccdc12 (Myc-DDK-tagged ORF) - Rat coiled-coil domain containing 12 (Ccdc12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ccdc12 (Myc-DDK-tagged ORF) - Rat coiled-coil domain containing 12 (Ccdc12), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ccdc12 (Myc-DDK-tagged ORF) - Rat coiled-coil domain containing 12 (Ccdc12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ccdc12 (mGFP-tagged ORF) - Rat coiled-coil domain containing 12 (Ccdc12), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ccdc12 (GFP-tagged ORF) - Rat coiled-coil domain containing 12 (Ccdc12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ccdc12 (untagged) - Mouse coiled-coil domain containing 12 (cDNA clone MGC:37643 IMAGE:5006213), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CCDC12 (untagged)-Human coiled-coil domain containing 12 (CCDC12)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of coiled-coil domain containing 12 (CCDC12)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-CCDC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CCDC12 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC12. Synthetic peptide located within the following region: EQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAE |
CCDC12 CRISPRa kit - CRISPR gene activation of human coiled-coil domain containing 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ccdc12 CRISPRa kit - CRISPR gene activation of mouse coiled-coil domain containing 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CCDC12
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CCDC12
CCDC12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Ccdc12
CCDC12 MS Standard C13 and N15-labeled recombinant protein (NP_653317)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ccdc12 (untagged ORF) - Rat coiled-coil domain containing 12 (Ccdc12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CCDC12 (untagged)-Human coiled-coil domain containing 12 (CCDC12)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CCDC12 (untagged) - Homo sapiens coiled-coil domain containing 12 (CCDC12), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
CCDC12 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ccdc12 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Ccdc12 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CCDC12 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Transient overexpression of CCDC12 (NM_144716) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCDC12 (NM_001277074) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CCDC12 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
CCDC12 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ccdc12 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ccdc12 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ccdc12 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ccdc12 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse coiled-coil domain containing 12 (Ccdc12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Active filters
Target Symbol
- CCDC12