Germany
Japan
United Kingdom
China
COASY (Myc-DDK-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
COASY (Myc-DDK-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
COASY (Myc-DDK-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Coasy (Myc-DDK-tagged) - Mouse Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
COASY (GFP-tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
COASY (Myc-DDK-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
COASY - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409424 is the updated version of KN209424.
Coasy - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503600 is the updated version of KN303600.
Coasy (GFP-tagged) - Mouse Coenzyme A synthase (Coasy) nuclear gene encoding mitochondrial protein, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Coasy (Myc-DDK-tagged) - Mouse Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coasy (Myc-DDK-tagged) - Mouse Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Coasy (mGFP-tagged) - Mouse Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coasy (GFP-tagged) - Mouse Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (Myc-DDK tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (mGFP-tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (Myc-DDK tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (mGFP-tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (Myc-DDK tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (mGFP-tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of COASY (Myc-DDK-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (Myc-DDK-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of COASY (mGFP-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, COASY (mGFP-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
COASY (GFP-tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
COASY (GFP-tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
COASY (GFP-tagged) - Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Coasy (Myc-DDK-tagged ORF) - Rat Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Coasy (Myc-DDK-tagged ORF) - Rat Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coasy (Myc-DDK-tagged ORF) - Rat Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Coasy (mGFP-tagged ORF) - Rat Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coasy (GFP-tagged ORF) - Rat Coenzyme A synthase (Coasy), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Coasy (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
COASY (untagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
COASY (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
COASY HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
COASY HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
COASY HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
COASY (untagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-COASY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COASY antibody is: synthetic peptide directed towards the C-terminal region of Human COASY. Synthetic peptide located within the following region: ETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQR |
Active filters
Target Symbol
- COASY