Germany
Japan
United Kingdom
China
Cr1l (Myc-DDK-tagged) - Mouse complement component (3b/4b) receptor 1-like (Cr1l)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadCR1L (Myc-DDK-tagged)-Human complement component (3b/4b) receptor 1-like (CR1L)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CR1L - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN417373 is the updated version of KN217373.
Cr1l - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503792 is the updated version of KN303792.
Cr1l (GFP-tagged) - Mouse complement receptor related protein (Crry)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cr1l (Myc-DDK-tagged) - Mouse complement component (3b/4b) receptor 1-like (Cr1l)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (Myc-DDK-tagged) - Mouse complement component (3b/4b) receptor 1-like (Cr1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cr1l (mGFP-tagged) - Mouse complement component (3b/4b) receptor 1-like (Cr1l)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (GFP-tagged) - Mouse complement component (3b/4b) receptor 1-like (Cr1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CR1L (Myc-DDK-tagged)-Human complement component (3b/4b) receptor 1-like (CR1L)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CR1L (Myc-DDK-tagged)-Human complement component (3b/4b) receptor 1-like (CR1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CR1L (mGFP-tagged)-Human complement component (3b/4b) receptor 1-like (CR1L)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CR1L (mGFP-tagged)-Human complement component (3b/4b) receptor 1-like (CR1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CR1L (GFP-tagged) - Human complement component (3b/4b) receptor 1-like (CR1L)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 1, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 1, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cr1l (mGFP-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 1, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (GFP-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 3, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 3, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cr1l (mGFP-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 3, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (GFP-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 2, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 2, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (Myc-DDK-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cr1l (mGFP-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 2, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cr1l (GFP-tagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cr1l (untagged) - Mouse complement component (3b/4b) receptor 1-like (Cr1l), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Cr1l (untagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 1, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Cr1l mouse monoclonal antibody, clone 512, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Rat |
Cr1l mouse monoclonal antibody, clone 512, Biotin
| Applications | FC, IHC |
| Reactivities | Rat |
| Conjugation | Biotin |
Cr1l mouse monoclonal antibody, clone 512, FITC
| Applications | FC, IHC |
| Reactivities | Rat |
| Conjugation | FITC |
Cr1l mouse monoclonal antibody, clone 512, Purified
| Applications | FC, IHC |
| Reactivities | Rat |
Rabbit Polyclonal Anti-CR1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CR1L antibody is: synthetic peptide directed towards the middle region of Human CR1L. Synthetic peptide located within the following region: ALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYD |
Rabbit Polyclonal Anti-CR1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CR1L antibody is: synthetic peptide directed towards the N-terminal region of Human CR1L. Synthetic peptide located within the following region: IGTYLNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGM |
CR1L CRISPRa kit - CRISPR gene activation of human complement C3b/C4b receptor 1 like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cr1l CRISPRa kit - CRISPR gene activation of mouse complement component (3b/4b) receptor 1-like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene CR1L
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Crry
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Cr1l
Cr1l (untagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 3, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Cr1l (untagged ORF) - Rat complement component (3b/4b) receptor 1-like (Cr1l), transcript variant 2, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CR1L (untagged)-Human complement component (3b/4b) receptor 1-like (CR1L)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CR1L (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cr1l (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Cr1l (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CR1L rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CR1L |
Active filters
Target Symbol
- CR1L