Products

Antibodies (49)
cDNA Clones (38)
RNAi (13)
Proteins (10)
Gene Expression (8)
Jump to Filters
View as table Download
CSNK1G2 (NM_001319) Human Tagged ORF Clone
RC202145

USD 420.00

In Stock

CSNK1G2 (Myc-DDK-tagged)-Human casein kinase 1, gamma 2 (CSNK1G2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Csnk1g2 (NM_134002) Mouse Tagged ORF Clone
MR207046

USD 350.00

In Stock

Csnk1g2 (Myc-DDK-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CSNK1G2 Human Gene Knockout Kit (CRISPR)
KN402145

USD 1,290.00

2 Weeks

CSNK1G2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402145 is the updated version of KN202145.
Csnk1g2 Mouse Gene Knockout Kit (CRISPR)
KN503906

USD 1,290.00

2 Weeks

Csnk1g2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503906 is the updated version of KN303906.
Csnk1g2 (NM_134002) Mouse Tagged ORF Clone
MG207046

USD 390.00

3 Weeks

Csnk1g2 (GFP-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Csnk1g2 (NM_001159591) Mouse Tagged ORF Clone
MG216302

USD 480.00

3 Weeks

Csnk1g2 (GFP-tagged) - Mouse casein kinase 1 gamma 2 (Csnk1g2) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Csnk1g2 (NM_134002) Mouse Tagged ORF Clone
MR207046L3

USD 550.00

3 Weeks

Lenti ORF clone of Csnk1g2 (Myc-DDK-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_134002) Mouse Tagged ORF Clone Lentiviral Particle
MR207046L3V

USD 750.00

6 Weeks

Lenti ORF particles, Csnk1g2 (Myc-DDK-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_134002) Mouse Tagged ORF Clone
MR207046L4

USD 550.00

3 Weeks

Lenti ORF clone of Csnk1g2 (mGFP-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_134002) Mouse Tagged ORF Clone Lentiviral Particle
MR207046L4V

USD 750.00

6 Weeks

Lenti ORF particles, Csnk1g2 (GFP-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001159591) Mouse Tagged ORF Clone
MR216302

USD 440.00

3 Weeks

Csnk1g2 (Myc-DDK-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Csnk1g2 (NM_001159591) Mouse Tagged ORF Clone
MR216302L3

USD 640.00

3 Weeks

Lenti ORF clone of Csnk1g2 (Myc-DDK-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001159591) Mouse Tagged ORF Clone Lentiviral Particle
MR216302L3V

USD 840.00

6 Weeks

Lenti ORF particles, Csnk1g2 (Myc-DDK-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001159591) Mouse Tagged ORF Clone
MR216302L4

USD 640.00

3 Weeks

Lenti ORF clone of Csnk1g2 (mGFP-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001159591) Mouse Tagged ORF Clone Lentiviral Particle
MR216302L4V

USD 840.00

6 Weeks

Lenti ORF particles, Csnk1g2 (GFP-tagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CSNK1G2 (NM_001319) Human Tagged ORF Clone
RC202145L3

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, gamma 2 (CSNK1G2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CSNK1G2 (NM_001319) Human Tagged ORF Clone
RC202145L4

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, gamma 2 (CSNK1G2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CSNK1G2 (NM_001319) Human Tagged ORF Clone
RG202145

USD 460.00

3 Weeks

CSNK1G2 (GFP-tagged) - Human casein kinase 1, gamma 2 (CSNK1G2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Csnk1g2 (NM_023102) Rat Tagged ORF Clone
RR200302

USD 420.00

4 Weeks

Csnk1g2 (Myc-DDK-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Csnk1g2 (NM_023102) Rat Tagged ORF Clone
RR200302L3

USD 640.00

8 Weeks

Lenti ORF clone of Csnk1g2 (Myc-DDK-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_023102) Rat Tagged ORF Clone Lentiviral Particle
RR200302L3V

USD 850.00

12 Weeks

Lenti ORF particles, Csnk1g2 (Myc-DDK-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_023102) Rat Tagged ORF Clone
RR200302L4

USD 700.00

8 Weeks

Lenti ORF clone of Csnk1g2 (mGFP-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_023102) Rat Tagged ORF Clone Lentiviral Particle
RR200302L4V

USD 960.00

12 Weeks

Lenti ORF particles, Csnk1g2 (GFP-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001033870) Rat Tagged ORF Clone
RR200303

USD 420.00

4 Weeks

Csnk1g2 (Myc-DDK-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Csnk1g2 (NM_001033870) Rat Tagged ORF Clone
RR200303L3

USD 640.00

8 Weeks

Lenti ORF clone of Csnk1g2 (Myc-DDK-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001033870) Rat Tagged ORF Clone Lentiviral Particle
RR200303L3V

USD 850.00

12 Weeks

Lenti ORF particles, Csnk1g2 (Myc-DDK-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001033870) Rat Tagged ORF Clone
RR200303L4

USD 700.00

8 Weeks

Lenti ORF clone of Csnk1g2 (mGFP-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Csnk1g2 (NM_001033870) Rat Tagged ORF Clone Lentiviral Particle
RR200303L4V

USD 960.00

12 Weeks

Lenti ORF particles, Csnk1g2 (GFP-tagged ORF) - Rat casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CSNK1G2 (NM_001319) Human Untagged Clone
SC119302

USD 310.00

In Stock

CSNK1G2 (untagged)-Human casein kinase 1, gamma 2 (CSNK1G2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CSNK1G2 (NM_001319) Human Tagged ORF Clone
RC202145L1

USD 768.00

In Stock

Lenti ORF clone of Human casein kinase 1, gamma 2 (CSNK1G2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CSNK1G2 (NM_001319) Human Untagged Clone
SC323375

USD 760.00

In Stock

CSNK1G2 (untagged)-Kinase deficient mutant (K75M) of Human casein kinase 1, gamma 2 (CSNK1G2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CSNK1G2 Rabbit Polyclonal Antibody
AP20394PU-N

USD 370.00

2 Weeks

CSNK1G2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Csnk1g2 (NM_134002) Mouse Untagged Clone
MC200463

USD 210.00

In Stock

Csnk1g2 (untagged) - Mouse casein kinase 1, gamma 2 (Csnk1g2), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
CSNK1G2 (NM_001319) Human Tagged ORF Clone
RC202145L2

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, gamma 2 (CSNK1G2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CSNK1G2 (NM_001319) Human Over-expression Lysate
LC400524

USD 121.00

In Stock

CSNK1G2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CSNK1G2 Human siRNA Oligo Duplex (Locus ID 1455)
SR301029

USD 430.00

In Stock

CSNK1G2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

CSNK1G2 Human shRNA Plasmid Kit (Locus ID 1455)
TF320315

USD 715.00

In Stock

CSNK1G2 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
CSNK1G2 (NM_001319) Human Recombinant Protein
TP761410

USD 215.00

In Stock

Purified recombinant protein of Human casein kinase 1, gamma 2 (CSNK1G2), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
CSNK1G2 Rabbit Polyclonal Antibody
TA340010

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the N terminal of human CSNK1G2. Synthetic peptide located within the following region: FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK
CSNK1G2 Rabbit Polyclonal Antibody
TA340011

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the middle region of human CSNK1G2. Synthetic peptide located within the following region: SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR
CSNK1G2 Mouse Monoclonal Antibody [Clone ID: OTI1D12]
CF802812

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1G2 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CSNK1G2 Mouse Monoclonal Antibody [Clone ID: OTI1A9]
CF802813

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1G2 mouse monoclonal antibody,clone OTI1A9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CSNK1G2 Mouse Monoclonal Antibody [Clone ID: OTI5F4]
CF802830

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1G2 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CSNK1G2 Mouse Monoclonal Antibody [Clone ID: OTI1H6]
CF802832

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1G2 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CSNK1G2 Mouse Monoclonal Antibody [Clone ID: OTI3G4]
CF802833

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1G2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated