Germany
Japan
United Kingdom
China
CTRB1 (Myc-DDK-tagged)-Human chymotrypsinogen B1 (CTRB1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CTRB1 (Myc-DDK tagged) - Human chymotrypsinogen B1 (CTRB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CTRB1 (mGFP-tagged) - Human chymotrypsinogen B1 (CTRB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human chymotrypsinogen B1 (CTRB1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Ctrb1 (Myc-DDK-tagged ORF) - Rat chymotrypsinogen B1 (Ctrb1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ctrb1 (Myc-DDK-tagged) - Mouse chymotrypsinogen B1 (Ctrb1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CTRB1 (GFP-tagged) - Human chymotrypsinogen B1 (CTRB1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CTRB1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402806 is the updated version of KN202806.
Ctrb1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503976 is the updated version of KN303976.
Ctrb1 (GFP-tagged) - Mouse chymotrypsinogen B1 (Ctrb1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ctrb1 (Myc-DDK-tagged) - Mouse chymotrypsinogen B1 (Ctrb1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ctrb1 (Myc-DDK-tagged) - Mouse chymotrypsinogen B1 (Ctrb1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ctrb1 (mGFP-tagged) - Mouse chymotrypsinogen B1 (Ctrb1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ctrb1 (GFP-tagged) - Mouse chymotrypsinogen B1 (Ctrb1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chymotrypsinogen B1 (CTRB1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CTRB1 (Myc-DDK tagged) - Human chymotrypsinogen B1 (CTRB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chymotrypsinogen B1 (CTRB1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CTRB1 (mGFP-tagged) - Human chymotrypsinogen B1 (CTRB1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ctrb1 (Myc-DDK-tagged ORF) - Rat chymotrypsinogen B1 (Ctrb1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ctrb1 (Myc-DDK-tagged ORF) - Rat chymotrypsinogen B1 (Ctrb1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ctrb1 (mGFP-tagged ORF) - Rat chymotrypsinogen B1 (Ctrb1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ctrb1 (GFP-tagged ORF) - Rat chymotrypsinogen B1 (Ctrb1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chymotrypsinogen B1 (CTRB1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CTRB1 (untagged)-Human chymotrypsinogen B1 (CTRB1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of chymotrypsinogen B1 (CTRB1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human chymotrypsinogen B1 (CTRB1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CTRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRB1 antibody: synthetic peptide directed towards the middle region of human CTRB1. Synthetic peptide located within the following region: VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND |
Rabbit Polyclonal Anti-CTRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRB1 antibody: synthetic peptide directed towards the N terminal of human CTRB1. Synthetic peptide located within the following region: MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS |
Rabbit Polyclonal Anti-CTRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRB1 antibody: synthetic peptide directed towards the middle region of human CTRB1. Synthetic peptide located within the following region: FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT |
Chymotrypsin human protein, 0.1 mg
| Protein Source | Pancreas |
CTRB1 CRISPRa kit - CRISPR gene activation of human chymotrypsinogen B1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ctrb1 CRISPRa kit - CRISPR gene activation of mouse chymotrypsinogen B1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CTRB1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CTRB1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
CTRB1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Ctrb1 (untagged) - Mouse chymotrypsinogen B1 (Ctrb1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ctrb1
CTRB1 MS Standard C13 and N15-labeled recombinant protein (NP_001897)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ctrb1 (untagged ORF) - Rat chymotrypsinogen B1 (Ctrb1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CTRB1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR319835 is the updated version of SR301067.
Ctrb1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Ctrb1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CTRB1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CTRB1 |
CTRB1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 79-263 of human CTRB1 (NP_001897.4). |
| Modifications | Unmodified |
Transient overexpression of CTRB1 (NM_001906) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CTRB1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
CTRB1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ctrb1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ctrb1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- CTRB1