EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Eif4e3 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E member 3 (Eif4e3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Eif4e3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Eif4e3 (GFP-tagged) - Mouse eukaryotic translation initiation factor 4E member 3 (Eif4e3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Eif4e3 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E member 3 (Eif4e3)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Eif4e3 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E member 3 (Eif4e3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Eif4e3 (mGFP-tagged) - Mouse eukaryotic translation initiation factor 4E member 3 (Eif4e3)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Eif4e3 (GFP-tagged) - Mouse eukaryotic translation initiation factor 4E member 3 (Eif4e3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EIF4E3 (mGFP-tagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EIF4E3 (myc-DDK-tagged) - Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EIF4E3 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EIF4E3 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EIF4E3 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EIF4E3 (GFP-tagged) - Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Eif4e3 (Myc-DDK-tagged ORF) - Rat eukaryotic translation initiation factor 4E member 3 (Eif4e3), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Eif4e3 (Myc-DDK-tagged ORF) - Rat eukaryotic translation initiation factor 4E member 3 (Eif4e3), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Eif4e3 (Myc-DDK-tagged ORF) - Rat eukaryotic translation initiation factor 4E member 3 (Eif4e3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Eif4e3 (mGFP-tagged ORF) - Rat eukaryotic translation initiation factor 4E member 3 (Eif4e3), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Eif4e3 (GFP-tagged ORF) - Rat eukaryotic translation initiation factor 4E member 3 (Eif4e3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-EIF4E3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4E3 antibody: synthetic peptide directed towards the middle region of human EIF4E3. Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH |
EIF4E3 (untagged)-Human eukaryotic translation initiation factor 4E family member 3 (EIF4E3), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
EIF4E3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Eif4e3 (untagged) - Mouse eukaryotic translation initiation factor 4E member 3 (Eif4e3), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EIF4E3 (untagged)-Homo sapiens, similar to RIKEN cDNA 1300018P11 gene, clone MGC:39820 IMAGE:5299499, complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
EIF4E3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Carrier-free (BSA/glycerol-free) EIF4E3 mouse monoclonal antibody,clone OTI2B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E3 mouse monoclonal antibody,clone OTI1D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EIF4E3 CRISPRa kit - CRISPR gene activation of human eukaryotic translation initiation factor 4E family member 3
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene EIF4E3
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene EIF4E3
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene EIF4E3