Products

View as table Download

EXOSC7 (Myc-DDK-tagged)-Human exosome component 7 (EXOSC7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, EXOSC7 (Myc-DDK tagged) - Human exosome component 7 (EXOSC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, EXOSC7 (mGFP-tagged) - Human exosome component 7 (EXOSC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

USD 68.00

USD 670.00

In Stock

Exosc7 (Myc-DDK-tagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

EXOSC7 (GFP-tagged) - Human exosome component 7 (EXOSC7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

EXOSC7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401419 is the updated version of KN201419.

Exosc7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN505448 is the updated version of KN305448.

Exosc7 (GFP-tagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Exosc7 (GFP-tagged) - Mouse exosome component 7 (Exosc7), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Exosc7 (Myc-DDK-tagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Exosc7 (Myc-DDK-tagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Exosc7 (mGFP-tagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Exosc7 (GFP-tagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Exosc7 (Myc-DDK-tagged) - Mouse exosome component 7 (Exosc7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Exosc7 (Myc-DDK-tagged) - Mouse exosome component 7 (Exosc7)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Exosc7 (mGFP-tagged) - Mouse exosome component 7 (Exosc7)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human exosome component 7 (EXOSC7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, EXOSC7 (Myc-DDK tagged) - Human exosome component 7 (EXOSC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human exosome component 7 (EXOSC7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, EXOSC7 (mGFP-tagged) - Human exosome component 7 (EXOSC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Exosc7 (Myc-DDK-tagged ORF) - Rat exosome component 7 (Exosc7), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Exosc7 (Myc-DDK-tagged ORF) - Rat exosome component 7 (Exosc7), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Exosc7 (mGFP-tagged ORF) - Rat exosome component 7 (Exosc7), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-EXOSC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD

Rabbit Polyclonal Anti-EXOSC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC

Transient overexpression lysate of exosome component 7 (EXOSC7), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human exosome component 7 (EXOSC7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human exosome component 7 (EXOSC7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

EXOSC7 (untagged)-Human exosome component 7 (EXOSC7), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

EXOSC7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

EXOSC7 (untagged)-Human exosome component 7 (EXOSC7), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

EXOSC7 (1-291, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

EXOSC7 (1-291, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EXOSC7 CRISPRa kit - CRISPR gene activation of human exosome component 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene EXOSC7

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene EXOSC7

Exosc7 (untagged) - Mouse exosome component 7 (Exosc7), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Exosc7 (untagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin