Products

cDNA Clones (48)
Proteins (22)
RNAi (12)
Gene Expression (8)
Antibodies (6)
Jump to Filters
View as table Download
GALK2 (NM_002044) Human Tagged ORF Clone
RC200475

USD 98.00

USD 560.00

In Stock

GALK2 (Myc-DDK-tagged)-Human galactokinase 2 (GALK2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GALK2 (NM_001001556) Human Tagged ORF Clone
RC216527

USD 420.00

In Stock

GALK2 (Myc-DDK-tagged)-Human galactokinase 2 (GALK2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GALK2 (NM_002044) Human Recombinant Protein
TP300475

USD 867.00

In Stock

Recombinant protein of human galactokinase 2 (GALK2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
GALK2 (NM_002044) Human Tagged ORF Clone Lentiviral Particle
RC200475L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, GALK2 (Myc-DDK tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GALK2 (NM_002044) Human Tagged ORF Clone Lentiviral Particle
RC200475L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, GALK2 (mGFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Galk2 (NM_175154) Mouse Tagged ORF Clone
MR216381

USD 420.00

In Stock

Galk2 (Myc-DDK-tagged) - Mouse galactokinase 2 (Galk2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GALK2 (NM_002044) Human Tagged ORF Clone
RG200475

USD 460.00

In Stock

GALK2 (GFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GALK2 Human Gene Knockout Kit (CRISPR)
KN400475

USD 1,290.00

2 Weeks

GALK2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400475 is the updated version of KN200475.
Galk2 Mouse Gene Knockout Kit (CRISPR)
KN506271

USD 1,290.00

2 Weeks

Galk2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506271 is the updated version of KN306271.
Galk2 (BC079843) Mouse Tagged ORF Clone
MG207321

USD 530.00

3 Weeks

Galk2 (GFP-tagged) - Mouse galactokinase 2 (cDNA clone MGC:100208 IMAGE:5690056)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Galk2 (NM_175154) Mouse Tagged ORF Clone
MG216381

USD 460.00

3 Weeks

Galk2 (GFP-tagged) - Mouse galactokinase 2 (Galk2), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Galk2 (BC079843) Mouse Tagged ORF Clone
MR207321

USD 480.00

2 Weeks

Galk2 (Myc-DDK-tagged) - Mouse galactokinase 2 (cDNA clone MGC:100208 IMAGE:5690056)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Galk2 (BC079843) Mouse Tagged ORF Clone
MR207321L3

USD 680.00

8 Weeks

Lenti ORF clone of Galk2 (Myc-DDK-tagged) - Mouse galactokinase 2 (cDNA clone MGC:100208 IMAGE:5690056)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Galk2 (BC079843) Mouse Tagged ORF Clone Lentiviral Particle
MR207321L3V

USD 880.00

11 Weeks

Lenti ORF particles, Galk2 (Myc-DDK-tagged) - Mouse galactokinase 2 (cDNA clone MGC:100208 IMAGE:5690056), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Galk2 (BC079843) Mouse Tagged ORF Clone
MR207321L4

USD 680.00

8 Weeks

Lenti ORF clone of Galk2 (mGFP-tagged) - Mouse galactokinase 2 (cDNA clone MGC:100208 IMAGE:5690056)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Galk2 (BC079843) Mouse Tagged ORF Clone Lentiviral Particle
MR207321L4V

USD 880.00

11 Weeks

Lenti ORF particles, Galk2 (GFP-tagged) - Mouse galactokinase 2 (cDNA clone MGC:100208 IMAGE:5690056), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Galk2 (NM_175154) Mouse Tagged ORF Clone
MR216381L3

USD 620.00

3 Weeks

Lenti ORF clone of Galk2 (Myc-DDK-tagged) - Mouse galactokinase 2 (Galk2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Galk2 (NM_175154) Mouse Tagged ORF Clone
MR216381L4

USD 620.00

3 Weeks

Lenti ORF clone of Galk2 (mGFP-tagged) - Mouse galactokinase 2 (Galk2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Galk2 (NM_001291002) Mouse Tagged ORF Clone
MR230012

USD 480.00

2 Weeks

Galk2 (myc-DDK-tagged) - Mouse galactokinase 2 (Galk2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GALK2 (NM_002044) Human Tagged Lenti ORF Clone
RC200475L3

USD 768.00

3 Weeks

Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_002044) Human Tagged ORF Clone Lentiviral Particle
RC200475L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, GALK2 (Myc-DDK tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_002044) Human Tagged Lenti ORF Clone
RC200475L4

USD 768.00

3 Weeks

Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_002044) Human Tagged ORF Clone Lentiviral Particle
RC200475L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, GALK2 (mGFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_001001556) Human Tagged ORF Clone
RC216527L3

USD 620.00

3 Weeks

Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_001001556) Human Tagged ORF Clone
RC216527L4

USD 620.00

3 Weeks

Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_001001556) Human Tagged ORF Clone Lentiviral Particle
RC216527L4V

USD 820.00

6 Weeks

Lenti ORF particles, GALK2 (mGFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_001289030) Human Tagged ORF Clone
RC238207

USD 420.00

2 Weeks

GALK2 (myc-DDK-tagged) - Human galactokinase 2 (GALK2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GALK2 (NM_001289031) Human Tagged ORF Clone
RC238208

USD 420.00

2 Weeks

GALK2 (myc-DDK-tagged) - Human galactokinase 2 (GALK2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GALK2 (NM_001001556) Human Tagged ORF Clone
RG216527

USD 460.00

3 Weeks

GALK2 (GFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Galk2 (NM_001013919) Rat Tagged ORF Clone
RR206485

USD 630.00

4 Weeks

Galk2 (Myc-DDK-tagged ORF) - Rat galactokinase 2 (Galk2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Galk2 (NM_001013919) Rat Tagged ORF Clone
RR206485L3

USD 820.00

8 Weeks

Lenti ORF clone of Galk2 (Myc-DDK-tagged ORF) - Rat galactokinase 2 (Galk2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Galk2 (NM_001013919) Rat Tagged ORF Clone
RR206485L4

USD 900.00

8 Weeks

Lenti ORF clone of Galk2 (mGFP-tagged ORF) - Rat galactokinase 2 (Galk2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALK2 (NM_002044) Human Tagged Lenti ORF Clone
RC200475L1

USD 768.00

In Stock

Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GALK2 (NM_002044) Human Tagged Lenti ORF Clone
RC200475L2

USD 768.00

3 Weeks

Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GALK2 (NM_002044) Human Untagged Clone
SC321371

USD 760.00

In Stock

GALK2 (untagged)-Human galactokinase 2 (GALK2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GALK2 (NM_001001556) Human Untagged Clone
SC122009

USD 750.00

In Stock

GALK2 (untagged)-Human galactokinase 2 (GALK2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GALK2 Human siRNA Oligo Duplex (Locus ID 2585)
SR301724

USD 430.00

In Stock

GALK2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GALK2 Rabbit Polyclonal Antibody
TA331254

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALK2 antibody is: synthetic peptide directed towards the C-terminal region of Human GALK2. Synthetic peptide located within the following region: TVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE
Galk2 Mouse shRNA Plasmid (Locus ID 69976)
TR504374

USD 715.00

2 Weeks

Galk2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Human GALK2 activation kit by CRISPRa
GA101726

USD 1,290.00

2 Weeks

GALK2 CRISPRa kit - CRISPR gene activation of human galactokinase 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Galk2 activation kit by CRISPRa
GA208384

USD 1,290.00

2 Weeks

Galk2 CRISPRa kit - CRISPR gene activation of mouse galactokinase 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
GALK2 Human qPCR Template Standard (NM_001001556)
HK208466

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GALK2

Application Plasmid of exact quantity for transcript copy number calculation
GALK2 Human qPCR Template Standard (NM_002044)
HK209031

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GALK2

Application Plasmid of exact quantity for transcript copy number calculation