Products

Antibodies (57)
cDNA Clones (37)
Proteins (16)
RNAi (15)
Gene Expression (12)
Jump to Filters
View as table Download
GATA3 (NM_001002295) Human Tagged ORF Clone
RC211904

USD 420.00

In Stock

GATA3 (Myc-DDK-tagged)-Human GATA binding protein 3 (GATA3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GATA3 (NM_002051) Human Tagged ORF Clone
RC201618

USD 420.00

In Stock

GATA3 (Myc-DDK-tagged)-Human GATA binding protein 3 (GATA3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GATA3 Goat Polyclonal Antibody
TA305795

USD 375.00

2 Weeks

Goat Anti-GATA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1.
Gata3 (NM_008091) Mouse Tagged ORF Clone
MR227460

USD 470.00

In Stock

Gata3 (Myc-DDK-tagged) - Mouse GATA binding protein 3 (Gata3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GATA3 (NM_002051) Human Untagged Clone
SC108486

USD 310.00

In Stock

GATA3 (untagged)-Human GATA binding protein 3 (GATA3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GATA3 (NM_001002295) Human Untagged Clone
SC300437

USD 760.00

In Stock

GATA3 (untagged)-Human GATA binding protein 3 (GATA3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GATA3 (NM_002051) Human Tagged ORF Clone Lentiviral Particle
RC201618L1V

USD 820.00

3 Weeks

Lenti ORF particles, GATA3 (Myc-DDK tagged) - Human GATA binding protein 3 (GATA3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GATA3 (NM_002051) Human Tagged ORF Clone Lentiviral Particle
RC201618L2V

USD 820.00

6 Weeks

Lenti ORF particles, GATA3 (mGFP-tagged) - Human GATA binding protein 3 (GATA3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone Lentiviral Particle
RC211904L1V

USD 820.00

3 Weeks

Lenti ORF particles, GATA3 (Myc-DDK tagged) - Human GATA binding protein 3 (GATA3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone Lentiviral Particle
RC211904L2V

USD 820.00

6 Weeks

Lenti ORF particles, GATA3 (mGFP-tagged) - Human GATA binding protein 3 (GATA3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone
RG211904

USD 460.00

In Stock

GATA3 (GFP-tagged) - Human GATA binding protein 3 (GATA3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GATA3 (NM_002051) Human Tagged ORF Clone
RG201618

USD 460.00

In Stock

GATA3 (GFP-tagged) - Human GATA binding protein 3 (GATA3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GATA3 Human Gene Knockout Kit (CRISPR)
KN401618

USD 1,290.00

2 Weeks

GATA3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401618 is the updated version of KN201618.
Gata3 Mouse Gene Knockout Kit (CRISPR)
KN506323

USD 1,290.00

2 Weeks

Gata3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506323 is the updated version of KN306323.
Gata3 (NM_008091) Mouse Tagged ORF Clone
MG227460

USD 520.00

3 Weeks

Gata3 (GFP-tagged) - Mouse GATA binding protein 3 (Gata3), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gata3 (NM_008091) Mouse Tagged ORF Clone
MR227460L4

USD 670.00

In Stock

Lenti ORF clone of Gata3 (mGFP-tagged) - Mouse GATA binding protein 3 (Gata3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_002051) Human Tagged ORF Clone
RC201618L3

USD 620.00

3 Weeks

Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_002051) Human Tagged ORF Clone Lentiviral Particle
RC201618L3V

USD 820.00

5 Weeks

Lenti ORF particles, GATA3 (Myc-DDK tagged) - Human GATA binding protein 3 (GATA3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_002051) Human Tagged ORF Clone
RC201618L4

USD 620.00

3 Weeks

Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_002051) Human Tagged ORF Clone Lentiviral Particle
RC201618L4V

USD 820.00

7 Weeks

Lenti ORF particles, GATA3 (mGFP-tagged) - Human GATA binding protein 3 (GATA3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone
RC211904L3

USD 620.00

In Stock

Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone Lentiviral Particle
RC211904L3V

USD 820.00

3 Weeks

Lenti ORF particles, GATA3 (Myc-DDK tagged) - Human GATA binding protein 3 (GATA3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone
RC211904L4

USD 620.00

In Stock

Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone Lentiviral Particle
RC211904L4V

USD 820.00

3 Weeks

Lenti ORF particles, GATA3 (mGFP-tagged) - Human GATA binding protein 3 (GATA3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gata3 (NM_133293) Rat Tagged ORF Clone
RR205255

USD 600.00

4 Weeks

Gata3 (Myc-DDK-tagged ORF) - Rat GATA binding protein 3 (Gata3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gata3 (NM_133293) Rat Tagged ORF Clone
RR205255L3

USD 800.00

9 Weeks

Lenti ORF clone of Gata3 (Myc-DDK-tagged ORF) - Rat GATA binding protein 3 (Gata3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gata3 (NM_133293) Rat Tagged ORF Clone Lentiviral Particle
RR205255L3V

USD 1,020.00

13 Weeks

Lenti ORF particles, Gata3 (Myc-DDK-tagged ORF) - Rat GATA binding protein 3 (Gata3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gata3 (NM_133293) Rat Tagged ORF Clone
RR205255L4

USD 880.00

9 Weeks

Lenti ORF clone of Gata3 (mGFP-tagged ORF) - Rat GATA binding protein 3 (Gata3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gata3 (NM_133293) Rat Tagged ORF Clone Lentiviral Particle
RR205255L4V

USD 1,130.00

13 Weeks

Lenti ORF particles, Gata3 (GFP-tagged ORF) - Rat GATA binding protein 3 (Gata3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_002051) Human Over-expression Lysate
LY400759

USD 396.00

In Stock

Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GATA3 (NM_001002295) Human Over-expression Lysate
LY424146

USD 605.00

In Stock

Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GATA3 Human siRNA Oligo Duplex (Locus ID 2625)
SR320264

USD 430.00

2 Weeks

GATA3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR320264 is the updated version of SR301744.
GATA3 Human qPCR Primer Pair (NM_001002295)
HP201163

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GATA3

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Gata3 (NM_008091) Mouse Tagged ORF Clone
MR227460L3

USD 828.00

In Stock

Lenti ORF clone of Gata3 (Myc-DDK-tagged) - Mouse GATA binding protein 3 (Gata3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GATA3 (NM_001002295) Human Tagged ORF Clone
RC211904L1

USD 768.00

In Stock

Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GATA3 (NM_002051) Human Tagged ORF Clone
RC201618L1

USD 768.00

In Stock

Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GATA3 Rabbit Polyclonal Antibody
TA306922

USD 430.00

In Stock

Rabbit Polyclonal GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3.
Gata3 Mouse qPCR Primer Pair (NM_008091)
MP205276

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Gata3

Gata3 Mouse shRNA Plasmid (Locus ID 14462)
TF513036

USD 715.00

In Stock

Gata3 - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
GATA3 Human shRNA Plasmid Kit (Locus ID 2625)
TL312833

USD 815.00

In Stock

GATA3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
GATA3 Rabbit Polyclonal Antibody
TA330598

USD 310.00

5 Days

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS
GATA3 Human shRNA Plasmid Kit (Locus ID 2625)
TR312833

USD 715.00

In Stock

GATA3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
Gata3 (NM_008091) Mouse Untagged Clone
MC215786

USD 600.00

In Stock

Gata3 (untagged) - Mouse GATA binding protein 3 (Gata3), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GATA3 Rabbit Polyclonal Antibody
TA313285

USD 345.00

In Stock

Rabbit polyclonal anti-GATA3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human GATA3.
GATA3 Rabbit Polyclonal Antibody
TA371895

USD 380.00

4 Weeks

GATA3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GATA3
GATA3 Human shRNA Plasmid Kit (Locus ID 2625)
TG312833

USD 715.00

In Stock

GATA3 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
E. coli Selection Kanamycin
Mammalian Cell Selection Puromycin
Gata3 Mouse shRNA Plasmid (Locus ID 14462)
TG513036

USD 715.00

In Stock

Gata3 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS