Products

cDNA Clones (33)
Antibodies (15)
RNAi (14)
Proteins (12)
Gene Expression (6)
Jump to Filters
View as table Download
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone
RC228433

USD 490.00

In Stock

HNF1B (Myc-DDK-tagged)-Human HNF1 homeobox B (HNF1B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Hnf1b (NM_009330) Mouse Tagged ORF Clone
MR222599

USD 520.00

In Stock

Hnf1b (Myc-DDK-tagged) - Mouse HNF1 homeobox B (Hnf1b)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnf1b (NM_009330) Mouse Tagged ORF Clone
MG222599

USD 570.00

In Stock

Hnf1b (GFP-tagged) - Mouse HNF1 homeobox B (Hnf1b), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNF1 beta (HNF1B) (NM_000458) Human Tagged ORF Clone
RG204453

USD 530.00

In Stock

HNF1B (GFP-tagged) - Human HNF1 homeobox B (HNF1B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNF1 beta (HNF1B) (NM_000458) Human Untagged Clone
SC122562

USD 310.00

In Stock

HNF1B (untagged)-Human HNF1 homeobox B (HNF1B), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Hnf1b Mouse Gene Knockout Kit (CRISPR)
KN507842

USD 1,290.00

2 Weeks

Hnf1b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507842 is the updated version of KN307842.
Hnf1b (NM_009330) Mouse Tagged ORF Clone
MR222599L3

USD 720.00

3 Weeks

Lenti ORF clone of Hnf1b (Myc-DDK-tagged) - Mouse HNF1 homeobox B (Hnf1b)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnf1b (NM_009330) Mouse Tagged ORF Clone
MR222599L4

USD 720.00

3 Weeks

Lenti ORF clone of Hnf1b (mGFP-tagged) - Mouse HNF1 homeobox B (Hnf1b)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnf1b (NM_001291269) Mouse Tagged ORF Clone
MR229896

USD 460.00

2 Weeks

Hnf1b (myc-DDK-tagged) - Mouse HNF1 homeobox B (Hnf1b), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnf1b (NM_001291268) Mouse Tagged ORF Clone
MR230413

USD 560.00

4 Weeks

Hnf1b (myc-DDK-tagged) - Mouse HNF1 homeobox B (Hnf1b), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HNF1 beta (HNF1B) (NM_000458) Human Tagged ORF Clone
RC204453L3

USD 680.00

3 Weeks

Lenti ORF clone of Human HNF1 homeobox B (HNF1B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone Lentiviral Particle
RC228433L3V

USD 890.00

6 Weeks

Lenti ORF particles, HNF1B (Myc-DDK tagged) - Human HNF1 homeobox B (HNF1B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone
RC228433L4

USD 690.00

3 Weeks

Lenti ORF clone of Human HNF1 homeobox B (HNF1B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNF1 beta (HNF1B) (NM_001165923) Human Tagged ORF Clone
RG228433

USD 540.00

3 Weeks

HNF1B (GFP-tagged) - Human HNF1 homeobox B (HNF1B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnf1b (NM_013103) Rat Tagged ORF Clone
RR202829

USD 750.00

5 Weeks

Hnf1b (Myc-DDK-tagged ORF) - Rat HNF1 homeobox B (Hnf1b), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnf1b (NM_013103) Rat Tagged ORF Clone
RR202829L3

USD 950.00

9 Weeks

Lenti ORF clone of Hnf1b (Myc-DDK-tagged ORF) - Rat HNF1 homeobox B (Hnf1b), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnf1b (NM_013103) Rat Tagged ORF Clone
RR202829L4

USD 1,040.00

9 Weeks

Lenti ORF clone of Hnf1b (mGFP-tagged ORF) - Rat HNF1 homeobox B (Hnf1b), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnf1b (NM_013103) Rat Tagged ORF Clone Lentiviral Particle
RR202829L4V

USD 1,300.00

13 Weeks

Lenti ORF particles, Hnf1b (GFP-tagged ORF) - Rat HNF1 homeobox B (Hnf1b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNF1B Human shRNA Plasmid Kit (Locus ID 6928)
TG308907

USD 715.00

In Stock

HNF1B - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
E. coli Selection Kanamycin
Mammalian Cell Selection Puromycin
HNF1 beta (HNF1B) (NM_000458) Human Over-expression Lysate
LY400162

USD 396.00

5 Days

Transient overexpression lysate of HNF1 homeobox B (HNF1B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HNF1B Human siRNA Oligo Duplex (Locus ID 6928)
SR304742

USD 430.00

In Stock

HNF1B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA347848

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody 

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2).
HNF1 beta (HNF1B) Human qPCR Primer Pair (NM_000458)
HP200438

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene HNF1B

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Hnf1b (NM_009330) Mouse Untagged Clone
MC218963

USD 750.00

In Stock

Hnf1b (untagged) - Mouse HNF1 homeobox B (Hnf1b), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
HNF1 beta (HNF1B) Goat Polyclonal Antibody
TA302622

USD 375.00

In Stock

Goat Polyclonal Antibody against TCF2 / VHNF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1.
HNF1 beta (HNF1B) (NM_000458) Human Over-expression Lysate
LC400162

USD 121.00

In Stock

HNF1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Hnf1b Mouse shRNA Plasmid (Locus ID 21410)
TG502230

USD 715.00

2 Weeks

Hnf1b - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
HNF1B Human shRNA Plasmid Kit (Locus ID 6928)
TR308907

USD 715.00

2 Weeks

HNF1B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
HNF1 beta (HNF1B) (C-term) Rabbit Polyclonal Antibody
AP52066PU-N

USD 450.00

2 Weeks

HNF1 beta (HNF1B) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 505-536 amino acids from the C-terminal region of human HNF1B
Hnf1b Mouse qPCR Primer Pair (NM_009330)
MP206263

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Hnf1b

HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA330246

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA330247

USD 310.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA332360

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HNF1B Antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA334721

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the C terminal of human HNF1B. Synthetic peptide located within the following region: QGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMIS
Human HNF1 beta (HNF1B) activation kit by CRISPRa
GA104781

USD 1,290.00

2 Weeks

HNF1B CRISPRa kit - CRISPR gene activation of human HNF1 homeobox B

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Hnf1b activation kit by CRISPRa
GA204236

USD 1,290.00

2 Weeks

Hnf1b CRISPRa kit - CRISPR gene activation of mouse HNF1 homeobox B

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
HNF1 beta (HNF1B) Human qPCR Template Standard (NM_000458)
HK203751

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene HNF1B

Application Plasmid of exact quantity for transcript copy number calculation
HNF1 beta (HNF1B) (NM_001165923) Human Over-expression Lysate
LC431461

USD 121.00

2 Weeks

HNF1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB