Products

cDNA Clones (42)
Antibodies (20)
Proteins (20)
RNAi (12)
Gene Expression (8)
Jump to Filters
View as table Download
IVD (NM_002225) Human Tagged ORF Clone
RC201077

USD 420.00

In Stock

IVD (Myc-DDK-tagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IVD (NM_001159508) Human Tagged ORF Clone
RC228318

USD 420.00

In Stock

IVD (Myc-DDK-tagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Tagged ORF Clone
RC229217

USD 420.00

In Stock

IVD (Myc-DDK-tagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L1V

USD 820.00

3 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L2V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L1V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L2V

USD 820.00

3 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RG201077

USD 460.00

In Stock

IVD (GFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ivd (NM_019826) Mouse Tagged ORF Clone
MR206749

USD 300.00

In Stock

Ivd (Myc-DDK-tagged) - Mouse isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IVD Human Gene Knockout Kit (CRISPR)
KN401077

USD 1,290.00

2 Weeks

IVD - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401077 is the updated version of KN201077.
Ivd Mouse Gene Knockout Kit (CRISPR)
KN508525

USD 1,290.00

2 Weeks

Ivd - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN508525 is the updated version of KN308525.
Ivd (NM_019826) Mouse Tagged ORF Clone
MG206749

USD 330.00

3 Weeks

Ivd (GFP-tagged) - Mouse isovaleryl coenzyme A dehydrogenase (Ivd)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ivd (NM_019826) Mouse Tagged ORF Clone
MR206749L3

USD 500.00

3 Weeks

Lenti ORF clone of Ivd (Myc-DDK-tagged) - Mouse isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ivd (NM_019826) Mouse Tagged ORF Clone Lentiviral Particle
MR206749L3V

USD 700.00

6 Weeks

Lenti ORF particles, Ivd (Myc-DDK-tagged) - Mouse isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ivd (NM_019826) Mouse Tagged ORF Clone
MR206749L4

USD 500.00

3 Weeks

Lenti ORF clone of Ivd (mGFP-tagged) - Mouse isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ivd (NM_019826) Mouse Tagged ORF Clone Lentiviral Particle
MR206749L4V

USD 700.00

6 Weeks

Lenti ORF particles, Ivd (GFP-tagged) - Mouse isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC201077L3

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L3V

USD 820.00

5 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC201077L4

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC201077L4V

USD 820.00

7 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone
RC228318L3

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone Lentiviral Particle
RC228318L3V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone
RC228318L4

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone Lentiviral Particle
RC228318L4V

USD 820.00

6 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC229217L3

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L3V

USD 820.00

7 Weeks

Lenti ORF particles, IVD (Myc-DDK tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC229217L4

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone Lentiviral Particle
RC229217L4V

USD 820.00

5 Weeks

Lenti ORF particles, IVD (mGFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_001159508) Human Tagged ORF Clone
RG228318

USD 460.00

3 Weeks

IVD (GFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IVD (NM_002225) Human Tagged ORF Clone
RG229217

USD 460.00

3 Weeks

IVD (GFP-tagged) - Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ivd (NM_012592) Rat Tagged ORF Clone
RR200814

USD 420.00

4 Weeks

Ivd (Myc-DDK-tagged ORF) - Rat isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ivd (NM_012592) Rat Tagged ORF Clone
RR200814L3

USD 640.00

9 Weeks

Lenti ORF clone of Ivd (Myc-DDK-tagged ORF) - Rat isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ivd (NM_012592) Rat Tagged ORF Clone Lentiviral Particle
RR200814L3V

USD 850.00

13 Weeks

Lenti ORF particles, Ivd (Myc-DDK-tagged ORF) - Rat isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ivd (NM_012592) Rat Tagged ORF Clone
RR200814L4

USD 700.00

9 Weeks

Lenti ORF clone of Ivd (mGFP-tagged ORF) - Rat isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ivd (NM_012592) Rat Tagged ORF Clone Lentiviral Particle
RR200814L4V

USD 960.00

13 Weeks

Lenti ORF particles, Ivd (GFP-tagged ORF) - Rat isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IVD (NM_002225) Human Tagged Lenti ORF Clone
RC229217L2

USD 768.00

In Stock

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC201077L1

USD 768.00

In Stock

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IVD Rabbit Polyclonal Antibody
TA344320

USD 475.00

5 Days

Rabbit Polyclonal Anti-IVD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV
Ivd (NM_019826) Mouse Untagged Clone
MC201026

USD 210.00

In Stock

Ivd (untagged) - Mouse isovaleryl coenzyme A dehydrogenase (Ivd), nuclear gene encoding mitochondrial protein, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Tagged ORF Clone
RC201077L2

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IVD (NM_002225) Human Tagged ORF Clone
RC229217L1

USD 620.00

3 Weeks

Lenti ORF clone of Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IVD Rabbit Polyclonal Antibody
TA308023

USD 415.00

5 Days

Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440)
IVD Human shRNA Plasmid Kit (Locus ID 3712)
TL312061

USD 815.00

In Stock

IVD - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
IVD (NM_002225) Human Over-expression Lysate
LC419463

USD 121.00

In Stock

IVD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IVD (NM_002225) Human Over-expression Lysate
LC432239

USD 121.00

In Stock

IVD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IVD (NM_002225) Human Untagged Clone
SC319252

USD 720.00

In Stock

IVD (untagged)-Human isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
IVD (NM_002225) Human Over-expression Lysate
LY419463

USD 396.00

5 Days

Transient overexpression lysate of isovaleryl Coenzyme A dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
IVD (33-426, His-tag) Human Protein
AR09386PU-L

USD 745.00

2 Weeks

IVD (33-426, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
IVD (33-426, His-tag) Human Protein
AR09386PU-N

USD 300.00

2 Weeks

IVD (33-426, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli