Germany
Japan
United Kingdom
China
KCNC1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
KCNC1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCNC1 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcnc1 (Myc-DDK-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant B
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcnc1 (Myc-DDK-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant A
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, KCNC1 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, KCNC1 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
KCNC1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415716 is the updated version of KN215716.
Kcnc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508619 is the updated version of KN308619.
Kcnc1 (GFP-tagged) - Mouse potassium voltage gated channel Shaw-related subfamily member 1 (Kcnc1) transcript variant B, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcnc1 (GFP-tagged) - Mouse potassium voltage gated channel Shaw-related subfamily member 1 (Kcnc1) transcript variant A, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Kcnc1 (Myc-DDK-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant B
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnc1 (Myc-DDK-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant B, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcnc1 (mGFP-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant B
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnc1 (GFP-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant B, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcnc1 (Myc-DDK-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant A
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnc1 (Myc-DDK-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant A, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcnc1 (mGFP-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant A
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnc1 (GFP-tagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant A, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNC1 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNC1 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNC1 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNC1 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
KCNC1 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcnc1 (Myc-DDK-tagged ORF) - Rat potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Kcnc1 (Myc-DDK-tagged ORF) - Rat potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnc1 (Myc-DDK-tagged ORF) - Rat potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcnc1 (mGFP-tagged ORF) - Rat potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnc1 (GFP-tagged ORF) - Rat potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Kcnc1 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
KCNC1 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310304 is the updated version of SC124010.
Kcnc1 (untagged) - Mouse potassium voltage gated channel, Shaw-related subfamily, member 1 (Kcnc1), transcript variant B, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant B, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
KCNC1 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
KCNC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human potassium voltage-gated channel, Shaw-related subfamily, member 1 (KCNC1), transcript variant A,Glu116-Ser160, with N-terminal His-ABP tag, expressed in E. coli, 50ug
| Tag | N-His-ABP |
| Expression Host | E. coli |
Rabbit polyclonal Anti-KV3.1b
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CKESPVIAKYMPTEAVRVT, corresponding to amino acid residues 567-585 of rat Kv3.1b .? ? Intracellular, C-terminus. |
Rabbit Polyclonal Potassium Channel Kv3.1 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122] |
Rabbit Polyclonal Anti-KCNC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC1 antibody: synthetic peptide directed towards the N terminal of human KCNC1. Synthetic peptide located within the following region: TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY |
KCNC1 CRISPRa kit - CRISPR gene activation of human potassium voltage-gated channel subfamily C member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Kcnc1 CRISPRa kit - CRISPR gene activation of mouse potassium voltage gated channel, Shaw-related subfamily, member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene KCNC1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- KCNC1