Products

View as table Download

Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Pabpc4 (Myc-DDK-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

PABPC4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN419691 is the updated version of KN219691.

Pabpc4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512732 is the updated version of KN312732.

Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:11665 IMAGE:3707766)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:66682 IMAGE:5696369)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pabpc4 (mGFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pabpc4 (mGFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pabpc4 (mGFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PABPC4 (GFP-tagged) - Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PABPC4 (GFP-tagged) - Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PABPC4 (GFP-tagged) - Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Pabpc4 (Myc-DDK-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Pabpc4 (Myc-DDK-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pabpc4 (Myc-DDK-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pabpc4 (mGFP-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pabpc4 (GFP-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-PABPC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PABPC4 antibody: synthetic peptide directed towards the N terminal of human PABPC4. Synthetic peptide located within the following region: AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS

Pabpc4 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS

Pabpc4 (untagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-PABPC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PABPC4 antibody: synthetic peptide directed towards the middle region of human PABPC4. Synthetic peptide located within the following region: RPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFG