Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Pabpc4 (Myc-DDK-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
PABPC4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Pabpc4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:11665 IMAGE:3707766)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:66682 IMAGE:5696369)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pabpc4 (mGFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pabpc4 (mGFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly A binding protein, cytoplasmic 4 (cDNA clone MGC:6685 IMAGE:3582181), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pabpc4 (mGFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pabpc4 (GFP-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PABPC4 (Myc-DDK-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PABPC4 (mGFP-tagged)-Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PABPC4 (GFP-tagged) - Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PABPC4 (GFP-tagged) - Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PABPC4 (GFP-tagged) - Human poly(A) binding protein, cytoplasmic 4 (inducible form) (PABPC4), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Pabpc4 (Myc-DDK-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pabpc4 (Myc-DDK-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pabpc4 (Myc-DDK-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pabpc4 (mGFP-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pabpc4 (GFP-tagged ORF) - Rat poly A binding protein, cytoplasmic 4 (Pabpc4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pabpc4 (Myc-DDK-tagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 2
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PABPC4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PABPC4 antibody: synthetic peptide directed towards the N terminal of human PABPC4. Synthetic peptide located within the following region: AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS |
Pabpc4 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
Pabpc4 (untagged) - Mouse poly(A) binding protein, cytoplasmic 4 (Pabpc4), transcript variant 1, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PABPC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PABPC4 antibody: synthetic peptide directed towards the middle region of human PABPC4. Synthetic peptide located within the following region: RPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFG |