Germany
Japan
United Kingdom
China
PCGF5 (Myc-DDK-tagged)-Human polycomb group ring finger 5 (PCGF5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, PCGF5 (Myc-DDK tagged) - Human polycomb group ring finger 5 (PCGF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PCGF5 (mGFP-tagged) - Human polycomb group ring finger 5 (PCGF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Pcgf5 (Myc-DDK-tagged) - Mouse polycomb group ring finger 5 (Pcgf5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCGF5 (Myc-DDK tagged) - Homo sapiens polycomb group ring finger 5 (PCGF5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCGF5 (Myc-DDK tagged) - Homo sapiens polycomb group ring finger 5 (PCGF5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCGF5 (GFP-tagged) - Human polycomb group ring finger 5 (PCGF5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCGF5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN408679 is the updated version of KN208679.
Pcgf5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN512951 is the updated version of KN312951.
Pcgf5 (GFP-tagged) - Mouse polycomb group ring finger 5 (Pcgf5), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pcgf5 (Myc-DDK-tagged) - Mouse polycomb group ring finger 5 (Pcgf5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pcgf5 (Myc-DDK-tagged) - Mouse polycomb group ring finger 5 (Pcgf5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pcgf5 (mGFP-tagged) - Mouse polycomb group ring finger 5 (Pcgf5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pcgf5 (GFP-tagged) - Mouse polycomb group ring finger 5 (Pcgf5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PCGF5 (Myc-DDK tagged) - Human polycomb group ring finger 5 (PCGF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PCGF5 (mGFP-tagged) - Human polycomb group ring finger 5 (PCGF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PCGF5 (GFP-tagged) - Homo sapiens polycomb group ring finger 5 (PCGF5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCGF5 (GFP-tagged) - Homo sapiens polycomb group ring finger 5 (PCGF5), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pcgf5 (Myc-DDK-tagged ORF) - Rat polycomb group ring finger 5 (Pcgf5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pcgf5 (Myc-DDK-tagged ORF) - Rat polycomb group ring finger 5 (Pcgf5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pcgf5 (Myc-DDK-tagged ORF) - Rat polycomb group ring finger 5 (Pcgf5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pcgf5 (mGFP-tagged ORF) - Rat polycomb group ring finger 5 (Pcgf5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pcgf5 (GFP-tagged ORF) - Rat polycomb group ring finger 5 (Pcgf5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PCGF5 (untagged)-Human polycomb group ring finger 5 (PCGF5)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Pcgf5 (untagged) - Mouse polycomb group ring finger 5 (Pcgf5), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of polycomb group ring finger 5 (PCGF5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
(untagged)-Human cDNA FLJ34726 fis, clone MESAN2006022
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
(untagged)-Human mRNA, cDNA DKFZp686I1251 (from clone DKFZp686I1251), complete cds
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Pcgf5 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rabbit Polyclonal Anti-PCGF5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCGF5 antibody: synthetic peptide directed towards the N terminal of human PCGF5. Synthetic peptide located within the following region: ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN |
PCGF5 CRISPRa kit - CRISPR gene activation of human polycomb group ring finger 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pcgf5 CRISPRa kit - CRISPR gene activation of mouse polycomb group ring finger 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PCGF5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PCGF5
PCGF5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Pcgf5
Pcgf5 (untagged ORF) - Rat polycomb group ring finger 5 (Pcgf5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PCGF5 (untagged) - Homo sapiens polycomb group ring finger 5 (PCGF5), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
PCGF5 (untagged) - Homo sapiens polycomb group ring finger 5 (PCGF5), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PCGF5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pcgf5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pcgf5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PCGF5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCGF5. |
Transient overexpression of PCGF5 (NM_032373) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PCGF5 (NM_001256549) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PCGF5 (NM_001257101) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- PCGF5