Germany
Japan
United Kingdom
China
PGAM1 (Myc-DDK-tagged)-Human phosphoglycerate mutase 1 (brain) (PGAM1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human phosphoglycerate mutase 1 (brain) (PGAM1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Pgam1 (Myc-DDK-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Pgam1 (Myc-DDK-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Pgam1 (GFP-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, PGAM1 (Myc-DDK tagged) - Human phosphoglycerate mutase 1 (brain) (PGAM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PGAM1 (mGFP-tagged) - Human phosphoglycerate mutase 1 (brain) (PGAM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PGAM1 (GFP-tagged) - Human phosphoglycerate mutase 1 (brain) (PGAM1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PGAM1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404054 is the updated version of KN204054.
Pgam1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513152 is the updated version of KN313152.
Pgam1 (GFP-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pgam1 (Myc-DDK-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pgam1 (Myc-DDK-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pgam1 (mGFP-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pgam1 (GFP-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoglycerate mutase 1 (brain) (PGAM1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PGAM1 (Myc-DDK tagged) - Human phosphoglycerate mutase 1 (brain) (PGAM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PGAM1 (mGFP-tagged) - Human phosphoglycerate mutase 1 (brain) (PGAM1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pgam1 (Myc-DDK-tagged ORF) - Rat phosphoglycerate mutase 1 (brain) (Pgam1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pgam1 (Myc-DDK-tagged ORF) - Rat phosphoglycerate mutase 1 (brain) (Pgam1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pgam1 (Myc-DDK-tagged ORF) - Rat phosphoglycerate mutase 1 (brain) (Pgam1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pgam1 (mGFP-tagged ORF) - Rat phosphoglycerate mutase 1 (brain) (Pgam1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pgam1 (GFP-tagged ORF) - Rat phosphoglycerate mutase 1 (brain) (Pgam1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pgam1 (mGFP-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phosphoglycerate mutase 1 (brain) (PGAM1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PGAM1 (untagged)-Human phosphoglycerate mutase 1 (brain) (PGAM1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoglycerate mutase 1 (brain) (PGAM1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PGAM1 (untagged)-Human phosphoglycerate mutase 1 (brain) (PGAM1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoglycerate mutase 1 (brain) (PGAM1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Pgam1 (untagged) - Mouse phosphoglycerate mutase 1 (Pgam1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of phosphoglycerate mutase 1 (brain) (PGAM1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 191 and 254 of PGAM1 (Uniprot ID#P18669) |
Lenti ORF clone of Pgam1 (Myc-DDK-tagged) - Mouse phosphoglycerate mutase 1 (Pgam1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PGAM1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Pgam1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Goat Polyclonal Antibody against PGAM1 / PGAM2 / PGAM4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KAMEAVAAQGKAKK, from the C Terminus of the protein sequence according to NP_002620.1; NP_000281.2; NP_001025062.1. |
Rabbit Polyclonal Anti-PGAM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM1. Synthetic peptide located within the following region: EEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGK |
PGAM1 (1-254, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PGAM1 (1-254, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PGAM1 (1-254, His-tag) mouse recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PGAM1 (1-254, His-tag) mouse recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PGAM1 CRISPRa kit - CRISPR gene activation of human phosphoglycerate mutase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pgam1 CRISPRa kit - CRISPR gene activation of mouse phosphoglycerate mutase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PGAM1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PGAM1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Pgam1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- PGAM1