Products

cDNA Clones (46)
Proteins (19)
Antibodies (14)
RNAi (14)
Gene Expression (9)
Assay Kits (1)
Jump to Filters
View as table Download
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone
RC207413

USD 98.00

USD 390.00

In Stock

PRDX2 (Myc-DDK-tagged)-Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone
RC209548

USD 98.00

USD 390.00

In Stock

PRDX2 (Myc-DDK-tagged)-Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Prdx2 (NM_011563) Mouse Tagged ORF Clone
MR201968

USD 420.00

In Stock

Prdx2 (Myc-DDK-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Prdx2 (NM_011563) Mouse Tagged ORF Clone Lentiviral Particle
MR201968L1V

USD 820.00

6 Weeks

Lenti ORF particles, Prdx2 (Myc-DDK-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Prdx2 (NM_011563) Mouse Tagged ORF Clone Lentiviral Particle
MR201968L2V

USD 820.00

In Stock

Lenti ORF particles, Prdx2 (GFP-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone Lentiviral Particle
RC207413L1V

USD 820.00

3 Weeks

Lenti ORF particles, PRDX2 (Myc-DDK tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone Lentiviral Particle
RC209548L1V

USD 820.00

3 Weeks

Lenti ORF particles, PRDX2 (Myc-DDK tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Prdx2 (NM_017169) Rat Tagged ORF Clone Lentiviral Particle
RR211420L1V

USD 850.00

8 Weeks

Lenti ORF particles, Prdx2 (Myc-DDK-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Prdx2 (NM_017169) Rat Tagged ORF Clone Lentiviral Particle
RR211420L2V

USD 960.00

4 Weeks

Lenti ORF particles, Prdx2 (GFP-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Recombinant Protein
TP309548

USD 823.00

In Stock

Recombinant protein of human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone
RG207413

USD 460.00

In Stock

PRDX2 (GFP-tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Prdx2 (NM_011563) Mouse Tagged ORF Clone
MG201968

USD 460.00

In Stock

Prdx2 (GFP-tagged) - Mouse peroxiredoxin 2 (Prdx2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone
RG209548

USD 460.00

In Stock

PRDX2 (GFP-tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Prdx2 (NM_017169) Rat Tagged ORF Clone
RR211420

USD 420.00

In Stock

Prdx2 (Myc-DDK-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Prdx2 Mouse Gene Knockout Kit (CRISPR)
KN513841

USD 1,290.00

2 Weeks

Prdx2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513841 is the updated version of KN313841.
Prdx2 (NM_011563) Mouse Tagged ORF Clone
MR201968L3

USD 620.00

3 Weeks

Lenti ORF clone of Prdx2 (Myc-DDK-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (NM_011563) Mouse Tagged ORF Clone Lentiviral Particle
MR201968L3V

USD 820.00

7 Weeks

Lenti ORF particles, Prdx2 (Myc-DDK-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (NM_011563) Mouse Tagged ORF Clone
MR201968L4

USD 620.00

3 Weeks

Lenti ORF clone of Prdx2 (mGFP-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (NM_011563) Mouse Tagged ORF Clone Lentiviral Particle
MR201968L4V

USD 820.00

5 Weeks

Lenti ORF particles, Prdx2 (GFP-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone
RC207413L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone Lentiviral Particle
RC207413L3V

USD 820.00

7 Weeks

Lenti ORF particles, PRDX2 (Myc-DDK tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone
RC207413L4

USD 620.00

In Stock

Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Tagged ORF Clone Lentiviral Particle
RC207413L4V

USD 820.00

3 Weeks

Lenti ORF particles, PRDX2 (mGFP-tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone
RC209548L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone Lentiviral Particle
RC209548L3V

USD 820.00

5 Weeks

Lenti ORF particles, PRDX2 (Myc-DDK tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone
RC209548L4

USD 620.00

3 Weeks

Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone Lentiviral Particle
RC209548L4V

USD 820.00

7 Weeks

Lenti ORF particles, PRDX2 (mGFP-tagged) - Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (NM_017169) Rat Tagged ORF Clone
RR211420L3

USD 640.00

4 Weeks

Lenti ORF clone of Prdx2 (Myc-DDK-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (NM_017169) Rat Tagged ORF Clone Lentiviral Particle
RR211420L3V

USD 850.00

8 Weeks

Lenti ORF particles, Prdx2 (Myc-DDK-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (NM_017169) Rat Tagged ORF Clone
RR211420L4

USD 700.00

4 Weeks

Lenti ORF clone of Prdx2 (mGFP-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (NM_017169) Rat Tagged ORF Clone Lentiviral Particle
RR211420L4V

USD 960.00

8 Weeks

Lenti ORF particles, Prdx2 (GFP-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Prdx2 (BC002034) Mouse Untagged Clone
MC200303

USD 210.00

In Stock

Prdx2 (untagged) - Mouse peroxiredoxin 2 (cDNA clone MGC:5935 IMAGE:3485635), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Prdx2 (NM_011563) Mouse Tagged Lenti ORF Clone
MR201968L2

USD 768.00

In Stock

Lenti ORF clone of Prdx2 (mGFP-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Prdx2 (NM_017169) Rat Tagged Lenti ORF Clone
RR211420L2

USD 864.00

In Stock

Lenti ORF clone of Prdx2 (mGFP-tagged ORF) - Rat peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Peroxiredoxin 2 (PRDX2) Rabbit Polyclonal Antibody
TA346601

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRDX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX2 antibody: synthetic peptide directed towards the middle region of human PRDX2. Synthetic peptide located within the following region: VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Untagged Clone
SC116505

USD 310.00

In Stock

PRDX2 (untagged)-Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Peroxiredoxin 2 (PRDX2) Rabbit Polyclonal Antibody
TA327212

USD 374.00

3 Weeks

PRDX2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX2
PRDX2 Human siRNA Oligo Duplex (Locus ID 7001)
SR304771

USD 430.00

In Stock

PRDX2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Peroxiredoxin-2 / PRDX2 (1-198) Human Protein
AR09187PU-L

USD 1,105.00

2 Weeks

Peroxiredoxin-2 / PRDX2 (1-198) human recombinant protein, 0.5 mg

Expression Host E. coli
Peroxiredoxin-2 / PRDX2 (1-198) Human Protein
AR09187PU-N

USD 415.00

2 Weeks

Peroxiredoxin-2 / PRDX2 (1-198) human recombinant protein, 0.1 mg

Expression Host E. coli
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Over-expression Lysate
LY405644

USD 396.00

In Stock

Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Prdx2 (NM_011563) Mouse Untagged Clone
MC202464

USD 210.00

In Stock

Prdx2 (untagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Tagged ORF Clone
RC209548L1

USD 620.00

In Stock

Lenti ORF clone of Human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PRDX2 Human shRNA Plasmid Kit (Locus ID 7001)
TR310194

USD 715.00

2 Weeks

PRDX2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
Peroxiredoxin 2 (PRDX2) Rabbit Polyclonal Antibody
TA590354

USD 409.00

In Stock

Rabbit Polyclonal Peroxiredoxin 2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the Middle Region
PRDX2 Human shRNA Plasmid Kit (Locus ID 7001)
TG310194

USD 715.00

In Stock

PRDX2 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
E. coli Selection Kanamycin
Mammalian Cell Selection Puromycin
Prdx2 (NM_011563) Mouse Tagged ORF Clone
MR201968L1

USD 620.00

3 Weeks

Lenti ORF clone of Prdx2 (Myc-DDK-tagged) - Mouse peroxiredoxin 2 (Prdx2), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®