Products

cDNA Clones (54)
Proteins (28)
Antibodies (16)
RNAi (12)
Gene Expression (8)
Assay Kits (1)
Jump to Filters
View as table Download
Pthlh (NM_008970) Mouse Tagged ORF Clone
MR201519

USD 68.00

USD 390.00

In Stock

Pthlh (Myc-DDK-tagged) - Mouse parathyroid hormone-like peptide (Pthlh)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pthlh (NM_012636) Rat Tagged ORF Clone
RR204451

USD 420.00

In Stock

Pthlh (Myc-DDK-tagged ORF) - Rat parathyroid hormone-like hormone (Pthlh), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pthlh Mouse Gene Knockout Kit (CRISPR)
KN514188

USD 1,290.00

2 Weeks

Pthlh - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514188 is the updated version of KN314188.
Pthlh (NM_008970) Mouse Tagged ORF Clone
MG201519

USD 300.00

3 Weeks

Pthlh (GFP-tagged) - Mouse parathyroid hormone-like peptide (Pthlh)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pthlh (NM_008970) Mouse Tagged ORF Clone
MR201519L3

USD 500.00

3 Weeks

Lenti ORF clone of Pthlh (Myc-DDK-tagged) - Mouse parathyroid hormone-like peptide (Pthlh)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pthlh (NM_008970) Mouse Tagged ORF Clone Lentiviral Particle
MR201519L3V

USD 700.00

6 Weeks

Lenti ORF particles, Pthlh (Myc-DDK-tagged) - Mouse parathyroid hormone-like peptide (Pthlh), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pthlh (NM_008970) Mouse Tagged ORF Clone
MR201519L4

USD 500.00

3 Weeks

Lenti ORF clone of Pthlh (mGFP-tagged) - Mouse parathyroid hormone-like peptide (Pthlh)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pthlh (NM_008970) Mouse Tagged ORF Clone Lentiviral Particle
MR201519L4V

USD 700.00

6 Weeks

Lenti ORF particles, Pthlh (GFP-tagged) - Mouse parathyroid hormone-like peptide (Pthlh), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_198964) Human Tagged ORF Clone Lentiviral Particle
RC203287L3V

USD 820.00

6 Weeks

Lenti ORF particles, PTHLH (Myc-DDK tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_198964) Human Tagged ORF Clone Lentiviral Particle
RC203287L4V

USD 820.00

6 Weeks

Lenti ORF particles, PTHLH (mGFP-tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_198966) Human Tagged ORF Clone Lentiviral Particle
RC212744L3V

USD 820.00

5 Weeks

Lenti ORF particles, PTHLH (Myc-DDK tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_198966) Human Tagged ORF Clone Lentiviral Particle
RC212744L4V

USD 820.00

7 Weeks

Lenti ORF particles, PTHLH (mGFP-tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_002820) Human Tagged ORF Clone Lentiviral Particle
RC212858L3V

USD 820.00

6 Weeks

Lenti ORF particles, PTHLH (Myc-DDK tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_002820) Human Tagged ORF Clone Lentiviral Particle
RC212858L4V

USD 820.00

6 Weeks

Lenti ORF particles, PTHLH (mGFP-tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_198965) Human Tagged ORF Clone Lentiviral Particle
RC223709L3V

USD 820.00

6 Weeks

Lenti ORF particles, PTHLH (Myc-DDK tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) (NM_198965) Human Tagged ORF Clone Lentiviral Particle
RC223709L4V

USD 820.00

6 Weeks

Lenti ORF particles, PTHLH (mGFP-tagged) - Human parathyroid hormone-like hormone (PTHLH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pthlh (NM_012636) Rat Tagged ORF Clone
RR204451L3

USD 640.00

4 Weeks

Lenti ORF clone of Pthlh (Myc-DDK-tagged ORF) - Rat parathyroid hormone-like hormone (Pthlh), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pthlh (NM_012636) Rat Tagged ORF Clone Lentiviral Particle
RR204451L3V

USD 850.00

8 Weeks

Lenti ORF particles, Pthlh (Myc-DDK-tagged ORF) - Rat parathyroid hormone-like hormone (Pthlh), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pthlh (NM_012636) Rat Tagged ORF Clone
RR204451L4

USD 700.00

4 Weeks

Lenti ORF clone of Pthlh (mGFP-tagged ORF) - Rat parathyroid hormone-like hormone (Pthlh), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pthlh (NM_012636) Rat Tagged ORF Clone Lentiviral Particle
RR204451L4V

USD 960.00

8 Weeks

Lenti ORF particles, Pthlh (GFP-tagged ORF) - Rat parathyroid hormone-like hormone (Pthlh), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA334682

USD 310.00

5 Days

Rabbit Polyclonal Anti-PTHLH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
Parathyroid hormone related protein (PTHLH) (NM_198966) Human Tagged ORF Clone
RC212744L1

USD 768.00

In Stock

Lenti ORF clone of Human parathyroid hormone-like hormone (PTHLH), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA364192

USD 400.00

2 Weeks

Rabbit polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); neat antiserum

Applications ELISA
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein.
Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
TA364197

USD 400.00

2 Weeks

Rabbit polyclonal anti (Tyr36)-pTH-Related Protein (1-36); neat antiserum

Applications ELISA
Reactivities Chicken
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein.
Parathyroid hormone related protein (PTHLH) Guinea Pig Polyclonal Antibody
TA364394

USD 545.00

2 Weeks

Guinea pig polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); neat antiserum

Applications ELISA
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein.
Pthlh (NM_008970) Mouse Untagged Clone
MC203245

USD 210.00

In Stock

Pthlh (untagged) - Mouse parathyroid hormone-like peptide (Pthlh), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin