Germany
Japan
United Kingdom
China
RBBP7 (Myc-DDK-tagged)-Human retinoblastoma binding protein 7 (RBBP7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
RBBP7 (Myc-DDK-tagged)-Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
6 Weeks
Lenti ORF particles, RBBP7 (Myc-DDK tagged) - Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, RBBP7 (mGFP-tagged) - Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Rbbp7 (Myc-DDK-tagged) - Mouse retinoblastoma binding protein 7 (Rbbp7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RBBP7 (GFP-tagged) - Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rbbp7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514533 is the updated version of KN314533.
Rbbp7 (GFP-tagged) - Mouse retinoblastoma binding protein 7 (Rbbp7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rbbp7 (Myc-DDK-tagged) - Mouse retinoblastoma binding protein 7 (Rbbp7)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rbbp7 (Myc-DDK-tagged) - Mouse retinoblastoma binding protein 7 (Rbbp7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rbbp7 (mGFP-tagged) - Mouse retinoblastoma binding protein 7 (Rbbp7)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rbbp7 (GFP-tagged) - Mouse retinoblastoma binding protein 7 (Rbbp7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RBBP7 (Myc-DDK tagged) - Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RBBP7 (mGFP-tagged) - Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of RBBP7 (Myc-DDK-tagged)-Human retinoblastoma binding protein 7 (RBBP7), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RBBP7 (Myc-DDK-tagged)-Human retinoblastoma binding protein 7 (RBBP7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of RBBP7 (mGFP-tagged)-Human retinoblastoma binding protein 7 (RBBP7), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RBBP7 (mGFP-tagged)-Human retinoblastoma binding protein 7 (RBBP7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RBBP7 (GFP-tagged) - Human retinoblastoma binding protein 7 (RBBP7), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rbbp7 (Myc-DDK-tagged ORF) - Rat retinoblastoma binding protein 7 (Rbbp7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rbbp7 (Myc-DDK-tagged ORF) - Rat retinoblastoma binding protein 7 (Rbbp7), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rbbp7 (Myc-DDK-tagged ORF) - Rat retinoblastoma binding protein 7 (Rbbp7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rbbp7 (mGFP-tagged ORF) - Rat retinoblastoma binding protein 7 (Rbbp7), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rbbp7 (GFP-tagged ORF) - Rat retinoblastoma binding protein 7 (Rbbp7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rbbp7 (untagged) - Mouse retinoblastoma binding protein 7 (cDNA clone MGC:6013 IMAGE:3600013), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RBBP7 (untagged)-Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human retinoblastoma binding protein 7 (RBBP7), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RBBP7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RBBP7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
RbAp46 (RBBP7) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human RBBP7 |
Rabbit polyclonal Anti-RBBP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the N terminal of human RBBP7. Synthetic peptide located within the following region: MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH |
Rabbit polyclonal Anti-RBBP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the middle region of human RBBP7. Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH |
RBBP7 CRISPRa kit - CRISPR gene activation of human RB binding protein 7, chromatin remodeling factor
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Rbbp7 CRISPRa kit - CRISPR gene activation of mouse retinoblastoma binding protein 7, chromatin remodeling factor
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RBBP7
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene RBBP7
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Mus musculus gene Rbbp7
RBBP7 MS Standard C13 and N15-labeled recombinant protein (NP_002884)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Active filters
Target Symbol
- RBBP7