Germany
Japan
United Kingdom
China
RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadRcor1 (Myc-DDK-tagged) - Mouse REST corepressor 1 (Rcor1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, RCOR1 (mGFP-tagged)-Human REST corepressor 1 (RCOR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Rcor1 (GFP-tagged) - Mouse REST corepressor 1 (Rcor1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RCOR1 (GFP-tagged) - Human REST corepressor 1 (RCOR1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RCOR1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN424027 is the updated version of KN224027.
Rcor1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514617 is the updated version of KN314617.
Lenti ORF clone of Rcor1 (Myc-DDK-tagged) - Mouse REST corepressor 1 (Rcor1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rcor1 (Myc-DDK-tagged) - Mouse REST corepressor 1 (Rcor1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rcor1 (mGFP-tagged) - Mouse REST corepressor 1 (Rcor1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rcor1 (GFP-tagged) - Mouse REST corepressor 1 (Rcor1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
11 Weeks
Lenti ORF particles, RCOR1 (mGFP-tagged)-Human REST corepressor 1 (RCOR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of RCOR1 (mGFP-tagged)-Human REST corepressor 1 (RCOR1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
RCOR1 (untagged)-Human REST corepressor 1 (RCOR1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RCOR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS |
Lenti-ORF clone of RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rcor1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-RCOR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS |
Lenti-ORF clone of RCOR1 (mGFP-tagged)-Human REST corepressor 1 (RCOR1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RCOR1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
(untagged)-Human cDNA: FLJ22959 fis, clone KAT10162
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Mouse Monoclonal Anti-Co-Rest/RCOR1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RCOR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RCOR1 Antibody: synthetic peptide directed towards the middle region of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS |
RCOR1 CRISPRa kit - CRISPR gene activation of human REST corepressor 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Rcor1 CRISPRa kit - CRISPR gene activation of mouse REST corepressor 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RCOR1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene RCOR1
Rcor1 (untagged) - Mouse REST corepressor 1 (Rcor1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Rcor1
RCOR1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RCOR1 |
CoREST/RCOR1 Rabbit polyclonal Antibody
| Applications | ChIP, IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 256-485 of human CoREST/CoREST/RCOR1 (NP_055971.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of RCOR1 (NM_015156) in HEK293T cells paraffin embedded controls for ICC/IHC staining
RCOR1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
RCOR1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Rcor1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rcor1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Rcor1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of RCOR1 (NM_015156) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RCOR1 (NM_015156) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RCOR1