Products

cDNA Clones (44)
Proteins (16)
RNAi (12)
Gene Expression (7)
Antibodies (5)
Jump to Filters
View as table Download
RRAS2 (NM_012250) Human Tagged ORF Clone
RC204591

USD 118.00

USD 429.00

In Stock

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RRAS2 (NM_012250) Human Tagged ORF Clone Lentiviral Particle
RC204591L3V

USD 1,020.00

6 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Tagged ORF Clone Lentiviral Particle
RC204591L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Recombinant Protein
TP304591

USD 823.00

In Stock

Recombinant protein of human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Rras2 (BC003871) Mouse Tagged ORF Clone
MG202123

USD 300.00

In Stock

Rras2 (GFP-tagged) - Mouse related RAS viral (r-ras) oncogene homolog 2 (cDNA clone MGC:6630 IMAGE:3492159)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rras2 (NM_025846) Mouse Tagged ORF Clone
MR202123

USD 68.00

USD 149.00

In Stock

Rras2 (Myc-DDK-tagged) - Mouse related RAS viral (r-ras) oncogene homolog 2 (Rras2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_012250) Human Tagged ORF Clone
RG204591

USD 460.00

In Stock

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 Human Gene Knockout Kit (CRISPR)
KN404591

USD 1,290.00

2 Weeks

RRAS2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404591 is the updated version of KN204591.
Rras2 Mouse Gene Knockout Kit (CRISPR)
KN515134

USD 1,290.00

2 Weeks

Rras2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515134 is the updated version of KN315134.
Rras2 (NM_025846) Mouse Tagged ORF Clone
MR202123L3

USD 500.00

3 Weeks

Lenti ORF clone of Rras2 (Myc-DDK-tagged) - Mouse related RAS viral (r-ras) oncogene homolog 2 (Rras2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rras2 (NM_025846) Mouse Tagged ORF Clone Lentiviral Particle
MR202123L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rras2 (Myc-DDK-tagged) - Mouse related RAS viral (r-ras) oncogene homolog 2 (Rras2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rras2 (NM_025846) Mouse Tagged ORF Clone
MR202123L4

USD 500.00

3 Weeks

Lenti ORF clone of Rras2 (mGFP-tagged) - Mouse related RAS viral (r-ras) oncogene homolog 2 (Rras2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rras2 (NM_025846) Mouse Tagged ORF Clone Lentiviral Particle
MR202123L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rras2 (GFP-tagged) - Mouse related RAS viral (r-ras) oncogene homolog 2 (Rras2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RC220668

USD 420.00

2 Weeks

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RC220668L3

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone Lentiviral Particle
RC220668L3V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RC220668L4

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone Lentiviral Particle
RC220668L4V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RC229556

USD 420.00

2 Weeks

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RC229556L3

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone Lentiviral Particle
RC229556L3V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RC229556L4

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone Lentiviral Particle
RC229556L4V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RC229627

USD 420.00

2 Weeks

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RC229627L3

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone Lentiviral Particle
RC229627L3V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RC229627L4

USD 620.00

8 Weeks

Lenti-ORF clone of RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone Lentiviral Particle
RC229627L4V

USD 820.00

11 Weeks

Lenti ORF particles, RRAS2 (mGFP-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_001102669) Human Tagged ORF Clone
RG220668

USD 460.00

3 Weeks

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177315) Human Tagged ORF Clone
RG229556

USD 460.00

3 Weeks

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RRAS2 (NM_001177314) Human Tagged ORF Clone
RG229627

USD 460.00

3 Weeks

RRAS2 (GFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rras2 (NM_001013434) Rat Tagged ORF Clone
RR200798

USD 420.00

4 Weeks

Rras2 (Myc-DDK-tagged ORF) - Rat related RAS viral (r-ras) oncogene homolog 2 (Rras2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rras2 (NM_001013434) Rat Tagged ORF Clone
RR200798L3

USD 640.00

9 Weeks

Lenti ORF clone of Rras2 (Myc-DDK-tagged ORF) - Rat related RAS viral (r-ras) oncogene homolog 2 (Rras2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rras2 (NM_001013434) Rat Tagged ORF Clone Lentiviral Particle
RR200798L3V

USD 850.00

13 Weeks

Lenti ORF particles, Rras2 (Myc-DDK-tagged ORF) - Rat related RAS viral (r-ras) oncogene homolog 2 (Rras2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rras2 (NM_001013434) Rat Tagged ORF Clone
RR200798L4

USD 700.00

9 Weeks

Lenti ORF clone of Rras2 (mGFP-tagged ORF) - Rat related RAS viral (r-ras) oncogene homolog 2 (Rras2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rras2 (NM_001013434) Rat Tagged ORF Clone Lentiviral Particle
RR200798L4V

USD 960.00

13 Weeks

Lenti ORF particles, Rras2 (GFP-tagged ORF) - Rat related RAS viral (r-ras) oncogene homolog 2 (Rras2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Tagged Lenti ORF Clone
RC204591L4

USD 768.00

In Stock

Lenti ORF clone of Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Untagged Clone
SC115460

USD 310.00

In Stock

RRAS2 (untagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RRAS2 (NM_012250) Human Untagged Clone
SC322652

USD 310.00

In Stock

RRAS2 (untagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RRAS2 (NM_012250) Human Tagged ORF Clone
RC204591L3

USD 768.00

3 Weeks

Lenti ORF clone of Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RRAS2 (NM_012250) Human Over-expression Lysate
LC415877

USD 121.00

In Stock

RRAS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Rras2 (BC003871) Mouse Untagged Clone
MC206455

USD 210.00

In Stock

Rras2 (untagged) - Mouse related RAS viral (r-ras) oncogene homolog 2 (cDNA clone MGC:6630 IMAGE:3492159), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
RRAS2 Rabbit Polyclonal Antibody
TA308124

USD 415.00

5 Days

Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 204 of TC21 (Uniprot ID#P62070)
RRAS2 Rabbit Polyclonal Antibody
TA319836

USD 430.00

5 Days

Rabbit Polyclonal RRAS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Rabbit polyclonal RRAS2 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human RRAS2.
RRAS2 Rabbit Polyclonal Antibody
TA334999

USD 375.00

5 Days

Rabbit Polyclonal Anti-RRAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RRAS2 antibody is: synthetic peptide directed towards the C-terminal region of Human RRAS2. Synthetic peptide located within the following region: EASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
RRAS2 / TC21 (1-201, His-tag) Human Protein
AR09279PU-L

USD 620.00

2 Weeks

RRAS2 / TC21 (1-201, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
RRAS2 / TC21 (1-201, His-tag) Human Protein
AR09279PU-N

USD 260.00

2 Weeks

RRAS2 / TC21 (1-201, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human RRAS2 activation kit by CRISPRa
GA107819

USD 1,290.00

2 Weeks

RRAS2 CRISPRa kit - CRISPR gene activation of human RAS related 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Rras2 activation kit by CRISPRa
GA207027

USD 1,290.00

2 Weeks

Rras2 CRISPRa kit - CRISPR gene activation of mouse related RAS viral (r-ras) oncogene 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector