Germany
Japan
United Kingdom
China
SLC5A9 (Myc-DDK-tagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, SLC5A9 (Myc-DDK tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SLC5A9 (mGFP-tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Slc5a9 (Myc-DDK-tagged) - Mouse solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC5A9 (Myc-DDK-tagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC5A9 (GFP-tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC5A9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421490 is the updated version of KN221490.
Slc5a9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN516166 is the updated version of KN316166.
Slc5a9 (GFP-tagged) - Mouse solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Slc5a9 (Myc-DDK-tagged) - Mouse solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc5a9 (Myc-DDK-tagged) - Mouse solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Slc5a9 (mGFP-tagged) - Mouse solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc5a9 (GFP-tagged) - Mouse solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, SLC5A9 (Myc-DDK tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC5A9 (mGFP-tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SLC5A9 (Myc-DDK-tagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC5A9 (Myc-DDK-tagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SLC5A9 (mGFP-tagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC5A9 (mGFP-tagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SLC5A9 (GFP-tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Slc5a9 (Myc-DDK-tagged ORF) - Rat solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Slc5a9 (Myc-DDK-tagged ORF) - Rat solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc5a9 (Myc-DDK-tagged ORF) - Rat solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Slc5a9 (mGFP-tagged ORF) - Rat solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Slc5a9 (GFP-tagged ORF) - Rat solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
SLC5A9 (untagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SLC5A9 (untagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 9 (SLC5A9), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-SLC5A9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC5A9 |
qSTAR qPCR primer pairs against Homo sapiens gene SLC5A9
Slc5a9 (untagged) - Mouse solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SGLT4 / SLC5A9 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Gibbon, Marmoset, Bovine (89%); Mouse (83%). |
SGLT4 / SLC5A9 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Bat, Bovine, Hamster, Elephant (93%); Turkey, Chicken (80%). |
SGLT4 / SLC5A9 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human SLC5A9. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Dog (94%); Bat, Horse, Pig, Opossum (88%); Elephant, Panda (82%). |
SGLT4 / SLC5A9 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Elephant, Dog (94%); Galago, Panda, Bovine, Horse, Pig (88%); Mouse, Bat (82%). |
Rabbit Polyclonal Anti-SLC5A9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A9 Antibody: synthetic peptide directed towards the N terminal of human SLC5A9. Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA |
SLC5A9 CRISPRa kit - CRISPR gene activation of human solute carrier family 5 member 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Slc5a9 CRISPRa kit - CRISPR gene activation of mouse solute carrier family 5 (sodium/glucose cotransporter), member 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Mus musculus gene Slc5a9
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Slc5a9
Slc5a9 (untagged ORF) - Rat solute carrier family 5 (sodium/glucose cotransporter), member 9 (Slc5a9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of solute carrier family 5 (sodium/glucose cotransporter) member 9 (SLC5A9) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of solute carrier family 5 (sodium/glucose cotransporter) member 9 (SLC5A9) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
SLC5A9 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Slc5a9 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR427382 is the updated version of SR419114.
SLC5A9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2). |
| Modifications | Unmodified |
Transient overexpression of SLC5A9 (NM_001011547) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- SLC5A9