Products

Antibodies (47)
cDNA Clones (31)
Gene Expression (12)
RNAi (12)
Proteins (10)
Jump to Filters
View as table Download
Srr (NM_013761) Mouse Tagged ORF Clone
MR205071

USD 300.00

In Stock

Srr (Myc-DDK-tagged) - Mouse serine racemase (Srr), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Serine racemase (SRR) (NM_021947) Human Tagged ORF Clone
RG210359

USD 460.00

In Stock

SRR (GFP-tagged) - Human serine racemase (SRR)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Srr (NM_001163311) Mouse Tagged ORF Clone
MR225116

USD 300.00

In Stock

Srr (Myc-DDK-tagged) - Mouse serine racemase (Srr), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Serine racemase (SRR) Human Gene Knockout Kit (CRISPR)
KN410359

USD 1,290.00

2 Weeks

SRR - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN410359 is the updated version of KN210359.
Srr Mouse Gene Knockout Kit (CRISPR)
KN516733

USD 1,290.00

2 Weeks

Srr - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN516733 is the updated version of KN316733.
Srr (NM_013761) Mouse Tagged ORF Clone
MG205071

USD 330.00

3 Weeks

Srr (GFP-tagged) - Mouse serine racemase (Srr)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Srr (NM_001163311) Mouse Tagged ORF Clone
MG225116

USD 330.00

3 Weeks

Srr (GFP-tagged) - Mouse serine racemase (Srr) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Srr (NM_013761) Mouse Tagged ORF Clone
MR205071L3

USD 500.00

3 Weeks

Lenti ORF clone of Srr (Myc-DDK-tagged) - Mouse serine racemase (Srr), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_013761) Mouse Tagged ORF Clone Lentiviral Particle
MR205071L3V

USD 700.00

6 Weeks

Lenti ORF particles, Srr (Myc-DDK-tagged) - Mouse serine racemase (Srr), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_013761) Mouse Tagged ORF Clone
MR205071L4

USD 500.00

3 Weeks

Lenti ORF clone of Srr (mGFP-tagged) - Mouse serine racemase (Srr), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_013761) Mouse Tagged ORF Clone Lentiviral Particle
MR205071L4V

USD 700.00

6 Weeks

Lenti ORF particles, Srr (GFP-tagged) - Mouse serine racemase (Srr), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_001163311) Mouse Tagged ORF Clone
MR225116L3

USD 500.00

3 Weeks

Lenti ORF clone of Srr (Myc-DDK-tagged) - Mouse serine racemase (Srr), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_001163311) Mouse Tagged ORF Clone
MR225116L4

USD 500.00

3 Weeks

Lenti ORF clone of Srr (mGFP-tagged) - Mouse serine racemase (Srr), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_001163311) Mouse Tagged ORF Clone Lentiviral Particle
MR225116L4V

USD 700.00

6 Weeks

Lenti ORF particles, Srr (GFP-tagged) - Mouse serine racemase (Srr), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_198757) Rat Tagged ORF Clone
RR203734

USD 420.00

4 Weeks

Srr (Myc-DDK-tagged ORF) - Rat serine racemase (Srr), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Srr (NM_198757) Rat Tagged ORF Clone
RR203734L3

USD 640.00

8 Weeks

Lenti ORF clone of Srr (Myc-DDK-tagged ORF) - Rat serine racemase (Srr), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_198757) Rat Tagged ORF Clone Lentiviral Particle
RR203734L3V

USD 850.00

12 Weeks

Lenti ORF particles, Srr (Myc-DDK-tagged ORF) - Rat serine racemase (Srr), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_198757) Rat Tagged ORF Clone
RR203734L4

USD 700.00

8 Weeks

Lenti ORF clone of Srr (mGFP-tagged ORF) - Rat serine racemase (Srr), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Srr (NM_198757) Rat Tagged ORF Clone Lentiviral Particle
RR203734L4V

USD 960.00

12 Weeks

Lenti ORF particles, Srr (GFP-tagged ORF) - Rat serine racemase (Srr), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Serine racemase (SRR) (NM_021947) Human Untagged Clone
SC112891

USD 310.00

In Stock

SRR (untagged)-Human serine racemase (SRR)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Serine racemase (SRR) (NM_021947) Human Over-expression Lysate
LY402897

USD 396.00

In Stock

Transient overexpression lysate of serine racemase (SRR)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Srr (NM_013761) Mouse Untagged Clone
MC203814

USD 210.00

In Stock

Srr (untagged) - Mouse serine racemase (Srr), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Serine racemase (SRR) Rabbit Polyclonal Antibody
TA344714

USD 475.00

5 Days

Rabbit Polyclonal Anti-SRR Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRR antibody: synthetic peptide directed towards the middle region of human SRR. Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
Serine racemase (SRR) (NM_021947) Human Tagged ORF Clone
RC210359L2

USD 620.00

3 Weeks

Lenti ORF clone of Human serine racemase (SRR), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Serine racemase (SRR) (NM_021947) Human Over-expression Lysate
LC402897

USD 121.00

In Stock

SRR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SRR Human qPCR Template Standard (NM_021947)
HK207040

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene SRR

Application Plasmid of exact quantity for transcript copy number calculation
Serine racemase (SRR) Human Gene Knockout Kit (CRISPR)
KN210359

USD 1,290.00

2 Weeks

SRR - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
Serine racemase / SRR (1-340, His-tag) Human Protein
AR50194PU-N

USD 845.00

2 Weeks

Serine racemase / SRR (1-340, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Serine racemase / SRR (1-340, His-tag) Human Protein
AR50194PU-S

USD 330.00

2 Weeks

Serine racemase / SRR (1-340, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI2E3]
CF500940

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI5D10]
CF500941

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI1D7]
CF500942

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI7B6]
CF500943

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI7B6 (formerly 7B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI9E8]
CF500949

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI7G6]
CF500958

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI7G6 (formerly 7G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI7E8]
CF500974

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI5G3]
CF500981

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Serine racemase (SRR) Mouse Monoclonal Antibody [Clone ID: OTI3B5]
CF501007

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SRR mouse monoclonal antibody, clone OTI3B5 (formerly 3B5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated