Germany
Japan
United Kingdom
China
TNFRSF9 (untagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadTNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Tnfrsf9 (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
In Stock
Lenti ORF particles, TNFRSF9 (mGFP-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TNFRSF9 (GFP-tagged) - Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfrsf9 (myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfrsf9 (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily member 9 (Tnfrsf9) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfrsf9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517992 is the updated version of KN317992.
Lenti ORF clone of Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Tnfrsf9 (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf9 (mGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf9 (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, TNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tnfrsf9 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tnfrsf9 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf9 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf9 (mGFP-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf9 (GFP-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tnfrsf9 (untagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 3, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Tnfrsf9 (mGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9).
| Tag | Tag Free |
| Expression Host | E. coli |
USD 1,020.00
3 Weeks
Lenti ORF particles, TNFRSF9 (mGFP-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf9 (mGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Tnfrsf9 (untagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene TNFRSF9
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Lenti ORF clone of Tnfrsf9 (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 9 (Tnfrsf9), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TNFRSF9 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Tnfrsf9 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rabbit Polyclonal Anti-TNFRSF9 Antibody
| Applications | WB |
| Reactivities | Canine, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
TNFRSF9 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Purified recombinant protein of human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), with C-terminal DDK/His tag, expressed in human cells, 20 µg
| Tag | C-DDK/His |
| Expression Host | HEK293 |
qSTAR qPCR primer pairs against Mus musculus gene Tnfrsf9
CD137 / TNFRSF9 (18-186, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD137 / TNFRSF9 (18-186, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD137 / TNFRSF9 (18-186, hIgG-His-tagged) human protein, 0.25 mg
| Tag | hIgG-His-tag |
| Expression Host | Insect |
CD137 / TNFRSF9 (18-186, hIgG-His-tagged) human protein, 50 µg
| Tag | hIgG-His-tag |
| Expression Host | Insect |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI5H5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TNFRSF9
Filter by
Species
Reactivities
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Tags
Vectors
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Unmodified (1)