Products

cDNA Clones (36)
Proteins (17)
Antibodies (15)
RNAi (11)
Gene Expression (7)
Assay Kits (2)
Jump to Filters
View as table Download
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone
RC204672

USD 420.00

In Stock

TNFSF13B (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone
MR225393

USD 68.00

USD 149.00

In Stock

Tnfsf13b (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BAFF (TNFSF13B) (NM_006573) Human Untagged Clone
SC116003

USD 310.00

In Stock

TNFSF13B (untagged)-Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone Lentiviral Particle
MR225393L1V

USD 700.00

3 Weeks

Lenti ORF particles, Tnfsf13b (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone Lentiviral Particle
MR225393L2V

USD 700.00

6 Weeks

Lenti ORF particles, Tnfsf13b (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone Lentiviral Particle
RC204672L1V

USD 820.00

3 Weeks

Lenti ORF particles, TNFSF13B (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone Lentiviral Particle
RC204672L2V

USD 820.00

6 Weeks

Lenti ORF particles, TNFSF13B (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone
MR225393L3

USD 500.00

In Stock

Lenti ORF clone of Tnfsf13b (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone
RG204672

USD 460.00

In Stock

TNFSF13B (GFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BAFF (TNFSF13B) (NM_006573) Human Recombinant Protein
TP304672

USD 439.00

4 Weeks

Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
BAFF (TNFSF13B) (NM_001145645) Human Tagged ORF Clone
RC227189

USD 420.00

In Stock

TNFSF13B (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BAFF (TNFSF13B) Human Gene Knockout Kit (CRISPR)
KN404672

USD 1,290.00

2 Weeks

TNFSF13B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404672 is the updated version of KN204672.
Tnfsf13b Mouse Gene Knockout Kit (CRISPR)
KN517998

USD 1,290.00

2 Weeks

Tnfsf13b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN517998 is the updated version of KN317998.
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone
MG225393

USD 300.00

3 Weeks

Tnfsf13b (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily member 13b (Tnfsf13b), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone Lentiviral Particle
MR225393L3V

USD 700.00

3 Weeks

Lenti ORF particles, Tnfsf13b (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone
MR225393L4

USD 500.00

3 Weeks

Lenti ORF clone of Tnfsf13b (mGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tnfsf13b (NM_033622) Mouse Tagged ORF Clone Lentiviral Particle
MR225393L4V

USD 700.00

7 Weeks

Lenti ORF particles, Tnfsf13b (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone Lentiviral Particle
RC204672L3V

USD 820.00

5 Weeks

Lenti ORF particles, TNFSF13B (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone Lentiviral Particle
RC204672L4V

USD 820.00

3 Weeks

Lenti ORF particles, TNFSF13B (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_001145645) Human Tagged ORF Clone
RC227189L3

USD 620.00

3 Weeks

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_001145645) Human Tagged ORF Clone Lentiviral Particle
RC227189L3V

USD 820.00

6 Weeks

Lenti ORF particles, TNFSF13B (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_001145645) Human Tagged ORF Clone
RC227189L4

USD 620.00

3 Weeks

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_001145645) Human Tagged ORF Clone Lentiviral Particle
RC227189L4V

USD 820.00

6 Weeks

Lenti ORF particles, TNFSF13B (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_001145645) Human Tagged ORF Clone
RG227189

USD 460.00

3 Weeks

TNFSF13B (GFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tnfsf13b (NM_001109112) Rat Tagged ORF Clone
RR209954

USD 420.00

4 Weeks

Tnfsf13b (Myc-DDK-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tnfsf13b (NM_001109112) Rat Tagged ORF Clone
RR209954L3

USD 640.00

9 Weeks

Lenti ORF clone of Tnfsf13b (Myc-DDK-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tnfsf13b (NM_001109112) Rat Tagged ORF Clone Lentiviral Particle
RR209954L3V

USD 850.00

13 Weeks

Lenti ORF particles, Tnfsf13b (Myc-DDK-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tnfsf13b (NM_001109112) Rat Tagged ORF Clone
RR209954L4

USD 700.00

9 Weeks

Lenti ORF clone of Tnfsf13b (mGFP-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tnfsf13b (NM_001109112) Rat Tagged ORF Clone Lentiviral Particle
RR209954L4V

USD 960.00

13 Weeks

Lenti ORF particles, Tnfsf13b (GFP-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BAFF (TNFSF13B) (NM_006573) Human Untagged Clone
SC320963

USD 310.00

In Stock

TNFSF13B (untagged)-Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
BAFF (TNFSF13B) (NM_006573) Human Over-expression Lysate
LY401966

USD 396.00

2 Weeks

Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Tnfsf13b (NM_033622) Mouse Tagged Lenti ORF Clone
MR225393L1

USD 624.00

In Stock

Lenti ORF clone of Tnfsf13b (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Tnfsf13b (NM_033622) Mouse Untagged Clone
MC209699

USD 420.00

In Stock

Tnfsf13b (untagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone
RC204672L1

USD 768.00

In Stock

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BAFF (TNFSF13B) Rabbit Polyclonal Antibody
TA306021

USD 430.00

In Stock

Rabbit Polyclonal BAFF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF.
BAFF (TNFSF13B) Rabbit Polyclonal Antibody
TA332966

USD 275.00

3 Weeks

Rabbit anti-TNFSF13B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFSF13B
BAFF (TNFSF13B) Human qPCR Primer Pair (NM_006573)
HP209495

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene TNFSF13B

BAFF (TNFSF13B) (NM_006573) Human Recombinant Protein
TP723025

USD 240.00

5 Days

Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1.

Tag Tag Free
Expression Host E. coli
Tnfsf13b (NM_033622) Mouse Recombinant Protein
TP723868

USD 270.00

5 Days

Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 13b (BAFF / Tnfsf13b)

Tag Tag Free
Expression Host CHO
BAFF (TNFSF13B) Rabbit Polyclonal Antibody
TA344292

USD 475.00

5 Days

Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
BAFF (TNFSF13B) Human shRNA Plasmid Kit (Locus ID 10673)
TR308726

USD 715.00

In Stock

TNFSF13B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Tnfsf13b Mouse qPCR Primer Pair (NM_033622)
MP217741

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Tnfsf13b

Tnfsf13b (NM_033622) Mouse Tagged ORF Clone
MR225393L2

USD 500.00

3 Weeks

Lenti ORF clone of Tnfsf13b (mGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BAFF (TNFSF13B) (NM_006573) Human Tagged ORF Clone
RC204672L2

USD 620.00

3 Weeks

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BAFF (TNFSF13B) (NM_001145645) Human Untagged Clone
SC326543

USD 660.00

In Stock

TNFSF13B (untagged)-Human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 2, mRNA

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
BAFF (TNFSF13B) (NM_006573) Human Recombinant Protein
TP700008

USD 748.00

In Stock

Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, secreted soluble form with N-terminal His tag, expressed in human cells

Tag N-DDK/His
Expression Host HEK293
BAFF (TNFSF13B) (NM_006573) Human Over-expression Lysate
LC401966

USD 121.00

In Stock

TNFSF13B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Tnfsf13b Mouse siRNA Oligo Duplex (Locus ID 24099)
SR408353

USD 430.00

In Stock

Tnfsf13b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
BAFF (TNFSF13B) Goat Polyclonal Antibody
TA328259

USD 285.00

5 Days

Anti-Human BAFF Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BAFF
BAFF (TNFSF13B) (NM_006573) Human Recombinant Protein
TP750018

USD 425.00

In Stock

Recombinant protein of human soluble BAFF (TNFSF13B) produced in E. coli.

Tag N-His
Expression Host E. coli