Products

cDNA Clones (44)
Proteins (23)
RNAi (12)
Gene Expression (10)
Antibodies (6)
Jump to Filters
View as table Download
VPS29 (NM_057180) Human Tagged ORF Clone
RC201460

USD 98.00

USD 390.00

In Stock

VPS29 (Myc-DDK-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VPS29 (NM_016226) Human Tagged ORF Clone
RC219311

USD 420.00

In Stock

VPS29 (Myc-DDK-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS29 (NM_016226) Human Tagged ORF Clone Lentiviral Particle
RC219311L1V

USD 820.00

3 Weeks

Lenti ORF particles, VPS29 (Myc-DDK-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
VPS29 (NM_016226) Human Tagged ORF Clone Lentiviral Particle
RC219311L2V

USD 820.00

6 Weeks

Lenti ORF particles, VPS29 (mGFP-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone Lentiviral Particle
RR214029L1V

USD 850.00

8 Weeks

Lenti ORF particles, Vps29 (Myc-DDK-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone Lentiviral Particle
RR214029L2V

USD 960.00

4 Weeks

Lenti ORF particles, Vps29 (GFP-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Vps29 (NM_019780) Mouse Tagged ORF Clone
MR201640

USD 68.00

USD 390.00

In Stock

Vps29 (Myc-DDK-tagged) - Mouse vacuolar protein sorting 29 (S. pombe) (Vps29)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS29 (NM_001282150) Human Tagged ORF Clone
RC236622

USD 420.00

In Stock

VPS29 (myc-DDK-tagged) - Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS29 (NM_057180) Human Tagged ORF Clone
RG201460

USD 460.00

In Stock

VPS29 (GFP-tagged) - Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone
RR214029

USD 420.00

In Stock

Vps29 (Myc-DDK-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS29 Human Gene Knockout Kit (CRISPR)
KN401460

USD 1,290.00

2 Weeks

VPS29 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401460 is the updated version of KN201460.
Vps29 Mouse Gene Knockout Kit (CRISPR)
KN519250

USD 1,290.00

2 Weeks

Vps29 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN519250 is the updated version of KN319250.
Vps29 (NM_019780) Mouse Tagged ORF Clone
MG201640

USD 300.00

3 Weeks

Vps29 (GFP-tagged) - Mouse vacuolar protein sorting 29 (S. pombe) (Vps29)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vps29 (NM_019780) Mouse Tagged ORF Clone
MR201640L3

USD 500.00

3 Weeks

Lenti ORF clone of Vps29 (Myc-DDK-tagged) - Mouse vacuolar protein sorting 29 (S. pombe) (Vps29)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vps29 (NM_019780) Mouse Tagged ORF Clone Lentiviral Particle
MR201640L3V

USD 700.00

6 Weeks

Lenti ORF particles, Vps29 (Myc-DDK-tagged) - Mouse vacuolar protein sorting 29 (S. pombe) (Vps29), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vps29 (NM_019780) Mouse Tagged ORF Clone
MR201640L4

USD 500.00

3 Weeks

Lenti ORF clone of Vps29 (mGFP-tagged) - Mouse vacuolar protein sorting 29 (S. pombe) (Vps29)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vps29 (NM_019780) Mouse Tagged ORF Clone Lentiviral Particle
MR201640L4V

USD 700.00

6 Weeks

Lenti ORF particles, Vps29 (GFP-tagged) - Mouse vacuolar protein sorting 29 (S. pombe) (Vps29), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_057180) Human Tagged ORF Clone
RC201460L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_057180) Human Tagged ORF Clone Lentiviral Particle
RC201460L3V

USD 820.00

6 Weeks

Lenti ORF particles, VPS29 (Myc-DDK tagged) - Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_057180) Human Tagged ORF Clone
RC201460L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_057180) Human Tagged ORF Clone Lentiviral Particle
RC201460L4V

USD 820.00

6 Weeks

Lenti ORF particles, VPS29 (mGFP-tagged) - Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_016226) Human Tagged ORF Clone
RC219311L3

USD 620.00

3 Weeks

Lenti-ORF clone of VPS29 (Myc-DDK-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_016226) Human Tagged ORF Clone Lentiviral Particle
RC219311L3V

USD 820.00

11 Weeks

Lenti ORF particles, VPS29 (Myc-DDK-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_016226) Human Tagged ORF Clone
RC219311L4

USD 620.00

3 Weeks

Lenti-ORF clone of VPS29 (mGFP-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_016226) Human Tagged ORF Clone Lentiviral Particle
RC219311L4V

USD 820.00

11 Weeks

Lenti ORF particles, VPS29 (mGFP-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS29 (NM_001282151) Human Tagged ORF Clone
RC235552

USD 420.00

2 Weeks

VPS29 (myc-DDK-tagged) - Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS29 (NM_016226) Human Tagged ORF Clone
RG219311

USD 460.00

3 Weeks

VPS29 (GFP-tagged) - Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone
RR214029L3

USD 640.00

4 Weeks

Lenti ORF clone of Vps29 (Myc-DDK-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone Lentiviral Particle
RR214029L3V

USD 850.00

8 Weeks

Lenti ORF particles, Vps29 (Myc-DDK-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone
RR214029L4

USD 700.00

4 Weeks

Lenti ORF clone of Vps29 (mGFP-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone Lentiviral Particle
RR214029L4V

USD 960.00

8 Weeks

Lenti ORF particles, Vps29 (GFP-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vps29 (NM_001105932) Rat Tagged Lenti ORF Clone
RR214029L2

USD 864.00

In Stock

Lenti ORF clone of Vps29 (mGFP-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), (10 ug)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
VPS29 (NM_016226) Human Tagged ORF Clone
RC219311L1

USD 620.00

In Stock

Lenti-ORF clone of VPS29 (Myc-DDK-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
VPS29 Rabbit Polyclonal Antibody
TA383258

USD 275.00

3 Weeks

VPS29 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human VPS29 (NP_476528.1).
Modifications Unmodified
VPS29 Rabbit Polyclonal Antibody
TA383258S

USD 85.00

3 Weeks

VPS29 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human VPS29 (NP_476528.1).
Modifications Unmodified
VPS29 Human siRNA Oligo Duplex (Locus ID 51699)
SR309920

USD 430.00

In Stock

VPS29 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

VPS29 Rabbit Polyclonal Antibody
TA345052

USD 475.00

5 Days

Rabbit Polyclonal Anti-VPS29 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS29 antibody: synthetic peptide directed towards the N terminal of human VPS29. Synthetic peptide located within the following region: LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL
VPS29 (NM_016226) Human Over-expression Lysate
LC414109

USD 121.00

In Stock

VPS29 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS29 (NM_016226) Human Tagged ORF Clone
RC219311L2

USD 620.00

3 Weeks

Lenti-ORF clone of VPS29 (mGFP-tagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Vps29 (NM_001105932) Rat Tagged ORF Clone
RR214029L1

USD 640.00

4 Weeks

Lenti ORF clone of Vps29 (Myc-DDK-tagged ORF) - Rat vacuolar protein sorting 29 homolog (S. cerevisiae) (Vps29), (10 ug)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
VPS29 (NM_016226) Human Untagged Clone
SC114392

USD 420.00

In Stock

VPS29 (untagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
VPS29 (BC032462) Human Untagged Clone
SC123493

USD 310.00

In Stock

VPS29 (untagged)-Human vacuolar protein sorting 29 (yeast) (cDNA clone MGC:40428 IMAGE:5197243), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
VPS29 (NM_057180) Human Untagged Clone
SC126952

USD 310.00

In Stock

VPS29 (untagged)-Human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
VPS29 Goat Polyclonal Antibody
AP22445PU-N

USD 375.00

5 Days

VPS29 goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_057310.1; NP_476528.1.
VPS29 Goat Polyclonal Antibody
AP23044PU-N

USD 440.00

2 Weeks

VPS29 goat polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Immunogen Synthetic peptide from an internal region of human VPS29
Vps29 (NM_019780) Mouse Untagged Clone
MC200554

USD 210.00

In Stock

Vps29 (untagged) - Mouse vacuolar protein sorting 29 (S. pombe) (Vps29), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
VPS29 Goat Polyclonal Antibody
TA302920

USD 375.00

5 Days

Goat Polyclonal Antibody against VPS29

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DDVKVERIEYKKP, from the C Terminus of the protein sequence according to NP_057310.1; NP_476528.1.
VPS29 (NM_016226) Human Over-expression Lysate
LY414109

USD 396.00

5 Days

Transient overexpression lysate of vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS29 (NM_057180) Human Mass Spec Standard
PH301460

USD 2,055.00

2 Weeks

VPS29 MS Standard C13 and N15-labeled recombinant protein (NP_476528)

Tag C-Myc/DDK
Expression Host HEK293