LXR beta (NR1H2) Rabbit Polyclonal Antibody

CAT#: TA343659

Rabbit Polyclonal Anti-NR1H2 Antibody

Product Images

WB Suggested Anti-NR1H2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: nuclear receptor subfamily 1 group H member 2
• Database Link:
  NP_009052
  Entrez Gene 7376 Human
  UniProt ID P55055
• Background: The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995). [supplied by OMIM]
• Synonyms: LXR-b; LXRB; NER; NER-I; RIP15; UNR
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 90%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors