Methionine Sulfoxide Reductase A (MSRA) Rabbit Polyclonal Antibody

CAT#: TA345123

Rabbit Polyclonal Anti-MSRA Antibody - middle region

Product Images

Host: Rabbit; Target Name: MSRA; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml; MSRA is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MSRA antibody is: synthetic peptide directed towards the middle region of Human MSRA. Synthetic peptide located within the following region: VYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: methionine sulfoxide reductase A
• Database Link:
  NP_036463
  Entrez Gene 4482 Human
  UniProt ID Q9UJ68
• Background: This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
• Synonyms: PMSR
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86%