CENPA (NM_001042426) Human Mass Spec Standard

CAT#: PH301602

CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001035891)

Product Images

Coomassie blue staining of purified CENPA protein (Cat# TP301602). The protein was produced from HEK293T cells transfected with CENPA cDNA clone (Cat# RC201602) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201602
• Predicted MW: 13 kDa
• Protein Sequence:
  Sequence Link

  >RC201602 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
  AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035891
• RefSeq Size: 1352
• RefSeq ORF: 342
• Synonyms: CenH3; CENP-A
• Locus ID: 1058
• UniProt ID: P49450
• Cytogenetics: 2p23.3
• Summary: 'Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]'