CENPA (NM_001042426) Human Recombinant Protein
CAT#: TP301602
Recombinant protein of human centromere protein A (CENPA), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201602 protein sequence
Red=Cloning site Green=Tags(s) MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035891 |
Locus ID | 1058 |
UniProt ID | P49450 |
Cytogenetics | 2p23.3 |
Refseq Size | 1352 |
Refseq ORF | 342 |
Synonyms | CenH3; CENP-A |
Summary | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400687 | CENPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420896 | CENPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400687 | Transient overexpression lysate of centromere protein A (CENPA), transcript variant 1 |
USD 396.00 |
|
LY420896 | Transient overexpression lysate of centromere protein A (CENPA), transcript variant 2 |
USD 396.00 |
|
PH301602 | CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001035891) |
USD 2,055.00 |
|
PH324761 | CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001800) |
USD 2,055.00 |
|
TP324761 | Recombinant protein of human centromere protein A (CENPA), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review