CENPA (NM_001042426) Human Recombinant Protein

CAT#: TP301602

Recombinant protein of human centromere protein A (CENPA), transcript variant 2

Product Images

Coomassie blue staining of purified CENPA protein (Cat# TP301602). The protein was produced from HEK293T cells transfected with CENPA cDNA clone (Cat# RC201602) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201602 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL
  AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035891
• Locus ID: 1058
• UniProt ID: P49450
• Cytogenetics: 2p23.3
• Refseq Size: 1352
• Refseq ORF: 342
• Synonyms: CenH3; CENP-A
• Summary: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]