SERPINB1 (NM_030666) Human Mass Spec Standard

CAT#: PH302138

SERPINB1 MS Standard C13 and N15-labeled recombinant protein (NP_109591)

Product Images

Coomassie blue staining of purified SERPINB1 protein (Cat# TP302138). The protein was produced from HEK293T cells transfected with SERPINB1 cDNA clone (Cat# RC202138) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202138
• Predicted MW: 42.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202138 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRF
  QSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQT
  EGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIE
  DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEE
  SYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE
  NFTADHPFLFFIRHNSSGSILFLGRFSSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_109591
• RefSeq Size: 2678
• RefSeq ORF: 1137
• Synonyms: EI; ELANH2; HEL-S-27; HEL57; LEI; M/NEI; MNEI; PI-2; PI2
• Locus ID: 1992
• UniProt ID: P30740, V9HWH1
• Cytogenetics: 6p25.2
• Summary: 'The protein encoded by this gene is a member of the serpin family of proteinase inhibitors. Members of this family maintain homeostasis by neutralizing overexpressed proteinase activity through their function as suicide substrates. This protein inhibits the neutrophil-derived proteinases neutrophil elastase, cathepsin G, and proteinase-3 and thus protects tissues from damage at inflammatory sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]'
• Protein Families: Druggable Genome