SERPINB1 (NM_030666) Human Recombinant Protein

CAT#: TP302138

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1)

Product Images

Linear correlations between plasma serpinB1 and insulin sensitivity index (SI) in 117 non-diabetic adult individuals. Both serpinB1 levels and SI are natural logs transformed. Pearson correlation coefficient (r) and the corresponding P values are shown. SerpinB1 was measured in plasma using ELISA with OriGene TP302138 SERPINB1 protein as the standard. Figure cited from Physiol Rep, PMID: 28292880

• 

  Coomassie blue staining of purified SERPINB1 protein (Cat# TP302138). The protein was produced from HEK293T cells transfected with SERPINB1 cDNA clone (Cat# RC202138) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202138 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRF
  QSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQT
  EGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIE
  DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEE
  SYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE
  NFTADHPFLFFIRHNSSGSILFLGRFSSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Peptidase assay (inhibitor) (PMID: 26701651)
  ELISA standard (PMID: 28292880)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_109591
• Locus ID: 1992
• UniProt ID: P30740, V9HWH1
• Cytogenetics: 6p25.2
• Refseq Size: 2678
• Refseq ORF: 1137
• Synonyms: EI; ELANH2; HEL-S-27; HEL57; LEI; M/NEI; MNEI; PI-2; PI2
• Summary: The protein encoded by this gene is a member of the serpin family of proteinase inhibitors. Members of this family maintain homeostasis by neutralizing overexpressed proteinase activity through their function as suicide substrates. This protein inhibits the neutrophil-derived proteinases neutrophil elastase, cathepsin G, and proteinase-3 and thus protects tissues from damage at inflammatory sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Protein Families: Druggable Genome