KCNK6 (NM_004823) Human Mass Spec Standard

CAT#: PH302421

KCNK6 MS Standard C13 and N15-labeled recombinant protein (NP_004814)

Product Images

Coomassie blue staining of purified KCNK6 protein (Cat# TP302421). The protein was produced from HEK293T cells transfected with KCNK6 cDNA clone (Cat# RC202421) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202421
• Predicted MW: 33.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202421 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG
  RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA
  SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI
  SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN
  ADEDDRVDILGPQPESHQQLSASSHTDYASIPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004814
• RefSeq Size: 2671
• RefSeq ORF: 939
• Synonyms: K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2
• Locus ID: 9424
• UniProt ID: Q9Y257, B2RDS2
• Cytogenetics: 19q13.2
• Summary: This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane