KCNK6 (NM_004823) Human Mass Spec Standard
CAT#: PH302421
KCNK6 MS Standard C13 and N15-labeled recombinant protein (NP_004814)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202421 |
Predicted MW | 33.7 kDa |
Protein Sequence |
>RC202421 protein sequence
Red=Cloning site Green=Tags(s) MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN ADEDDRVDILGPQPESHQQLSASSHTDYASIPR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004814 |
RefSeq Size | 2671 |
RefSeq ORF | 939 |
Synonyms | K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2 |
Locus ID | 9424 |
UniProt ID | Q9Y257, B2RDS2 |
Cytogenetics | 19q13.2 |
Summary | This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401515 | KCNK6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401515 | Transient overexpression lysate of potassium channel, subfamily K, member 6 (KCNK6) |
USD 325.00 |
|
TP302421 | Recombinant protein of human potassium channel, subfamily K, member 6 (KCNK6) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review