KCNK6 (NM_004823) Human Recombinant Protein

CAT#: TP302421

Recombinant protein of human potassium channel, subfamily K, member 6 (KCNK6)

Product Images

Coomassie blue staining of purified KCNK6 protein (Cat# TP302421). The protein was produced from HEK293T cells transfected with KCNK6 cDNA clone (Cat# RC202421) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202421 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG
  RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA
  SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI
  SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN
  ADEDDRVDILGPQPESHQQLSASSHTDYASIPR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004814
• Locus ID: 9424
• UniProt ID: Q9Y257, B2RDS2
• Cytogenetics: 19q13.2
• Refseq Size: 2671
• Refseq ORF: 939
• Synonyms: K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2
• Summary: This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane