CXCL5 (NM_002994) Human Mass Spec Standard

CAT#: PH302707

CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985)

Product Images

Coomassie blue staining of purified CXCL5 protein (Cat# TP302707). The protein was produced from HEK293T cells transfected with CXCL5 cDNA clone (Cat# RC202707) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202707
• Predicted MW: 12 kDa
• Protein Sequence:
  Sequence Link

  >RC202707 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA
  IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002985
• RefSeq Size: 2505
• RefSeq ORF: 342
• Synonyms: ENA-78; SCYB5
• Locus ID: 6374
• UniProt ID: P42830, Q6I9S7
• Cytogenetics: 4q13.3
• Summary: 'This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction