CXCL5 (NM_002994) Human Recombinant Protein
CAT#: TP302707
Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202707 protein sequence
Red=Cloning site Green=Tags(s) MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 8.3 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002985 |
| Locus ID | 6374 |
| UniProt ID | P42830, Q6I9S7 |
| Cytogenetics | 4q13.3 |
| Refseq Size | 2505 |
| Refseq ORF | 342 |
| Synonyms | ENA-78; SCYB5 |
| Summary | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401049 | CXCL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401049 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 5 (CXCL5) |
USD 436.00 |
|
| PH302707 | CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985) |
USD 2,055.00 |
|
| TP700192 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K mutant, 20 ug |
USD 748.00 |
|
| TP700193 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R48K mutant, 20 ug |
USD 748.00 |
|
| TP700194 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K and R48K double mutant, 20 ug |
USD 748.00 |
|
| TP720876 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5) |
USD 330.00 |
|
| TP723075 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5). |
USD 240.00 |
|
| TP723076 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5). |
USD 240.00 |
|
| TP723725 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5 / ENA-78) |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China