CXCL5 (NM_002994) Human Recombinant Protein
CAT#: TP723075
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
|
| Tag | Tag Free |
| Predicted MW | 8 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration of 5.0-10.0 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002985 |
| Locus ID | 6374 |
| UniProt ID | P42830, Q6I9S7 |
| Cytogenetics | 4q13.3 |
| Refseq Size | 2505 |
| Refseq ORF | 342 |
| Synonyms | ENA-78; SCYB5 |
| Summary | 'This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401049 | CXCL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401049 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 5 (CXCL5) |
USD 436.00 |
|
| PH302707 | CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985) |
USD 2,055.00 |
|
| TP302707 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5) |
USD 823.00 |
|
| TP700192 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K mutant, 20 ug |
USD 748.00 |
|
| TP700193 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R48K mutant, 20 ug |
USD 748.00 |
|
| TP700194 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K and R48K double mutant, 20 ug |
USD 748.00 |
|
| TP720876 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5) |
USD 330.00 |
|
| TP723076 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5). |
USD 240.00 |
|
| TP723725 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5 / ENA-78) |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China