SYNPR (NM_144642) Human Mass Spec Standard
CAT#: PH305424
SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205424 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC205424 protein sequence
Red=Cloning site Green=Tags(s) MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLA LIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLS DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRY LSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_653243 |
RefSeq Size | 2632 |
RefSeq ORF | 795 |
Synonyms | SPO |
Locus ID | 132204 |
UniProt ID | Q8TBG9 |
Cytogenetics | 3p14.2 |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403401 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427094 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403401 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2 |
USD 396.00 |
|
LY427094 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 1 |
USD 396.00 |
|
PH325395 | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) |
USD 2,055.00 |
|
TP305424 | Recombinant protein of human synaptoporin (SYNPR), transcript variant 2 |
USD 823.00 |
|
TP325395 | Purified recombinant protein of Homo sapiens synaptoporin (SYNPR), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review