SYNPR (NM_144642) Human Recombinant Protein

CAT#: TP305424

Recombinant protein of human synaptoporin (SYNPR), transcript variant 2

Product Images

Coomassie blue staining of purified SYNPR protein (Cat# TP305424). The protein was produced from HEK293T cells transfected with SYNPR cDNA clone (Cat# RC205424) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205424 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLA
  LIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLS
  DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRY
  LSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_653243
• Locus ID: 132204
• UniProt ID: Q8TBG9
• Cytogenetics: 3p14.2
• Refseq Size: 2632
• Refseq ORF: 795
• Synonyms: SPO
• Summary: Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane