SYNPR (NM_001130003) Human Mass Spec Standard

CAT#: PH325395

SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475)

Product Images

Coomassie blue staining of purified SYNPR protein (Cat# TP325395). The protein was produced from HEK293T cells transfected with SYNPR cDNA clone (Cat# RC225395) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225395
• Predicted MW: 31.1 kDa
• Protein Sequence:
  Sequence Link

  >RC225395 representing NM_001130003
  Red=Cloning site Green=Tags(s)
  
  MDPVSQLASAGTFRVLKEPLAFLRALELLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFR
  LHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV
  TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILW
  AGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTS
  FTNQI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001123475
• RefSeq ORF: 855
• Synonyms: SPO
• Locus ID: 132204
• UniProt ID: Q8TBG9
• Cytogenetics: 3p14.2
• Protein Families: Secreted Protein, Transmembrane