Cyclophilin 40 (PPID) (NM_005038) Human Mass Spec Standard
CAT#: PH306039
PPID MS Standard C13 and N15-labeled recombinant protein (NP_005029)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206039 |
Predicted MW | 40.8 kDa |
Protein Sequence |
>RC206039 protein sequence
Red=Cloning site Green=Tags(s) MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV KQKIKAQKDKEKAVYAKMFA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005029 |
RefSeq Size | 1851 |
RefSeq ORF | 1110 |
Synonyms | CYP-40; CYPD |
Locus ID | 5481 |
UniProt ID | Q08752, E5KN55 |
Cytogenetics | 4q32.1 |
Summary | 'The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]' |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Calcium signaling pathway, Huntington's disease, Parkinson's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401561 | PPID HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401561 | Transient overexpression lysate of peptidylprolyl isomerase D (PPID) |
USD 325.00 |
|
TP306039 | Recombinant protein of human peptidylprolyl isomerase D (PPID) |
USD 823.00 |
|
TP720861 | Purified recombinant protein of Human peptidylprolyl isomerase D (PPID) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review