Cyclophilin 40 (PPID) (NM_005038) Human Mass Spec Standard

CAT#: PH306039

PPID MS Standard C13 and N15-labeled recombinant protein (NP_005029)

Product Images

Coomassie blue staining of purified PPID protein (Cat# TP306039). The protein was produced from HEK293T cells transfected with PPID cDNA clone (Cat# RC206039) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206039
• Predicted MW: 40.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206039 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG
  CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP
  HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD
  IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG
  ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV
  KQKIKAQKDKEKAVYAKMFA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005029
• RefSeq Size: 1851
• RefSeq ORF: 1110
• Synonyms: CYP-40; CYPD
• Locus ID: 5481
• UniProt ID: Q08752, E5KN55
• Cytogenetics: 4q32.1
• Summary: 'The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]'
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease