Cyclophilin 40 (PPID) (NM_005038) Human Recombinant Protein

CAT#: TP306039

Recombinant protein of human peptidylprolyl isomerase D (PPID)

Product Images

Coomassie blue staining of purified PPID protein (Cat# TP306039). The protein was produced from HEK293T cells transfected with PPID cDNA clone (Cat# RC206039) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206039 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG
  CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP
  HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD
  IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG
  ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV
  KQKIKAQKDKEKAVYAKMFA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005029
• Locus ID: 5481
• UniProt ID: Q08752, E5KN55
• Cytogenetics: 4q32.1
• Refseq Size: 1851
• Refseq ORF: 1110
• Synonyms: CYP-40; CYPD
• Summary: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease