PRAS40 (AKT1S1) (NM_001098632) Human Mass Spec Standard
CAT#: PH311995
AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092102)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211995 |
| Predicted MW | 27.2 kDa |
| Protein Sequence |
>RC211995 representing NM_001098632
Red=Cloning site Green=Tags(s) MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001092102 |
| RefSeq Size | 2033 |
| RefSeq ORF | 768 |
| Synonyms | Lobe; PRAS40 |
| Locus ID | 84335 |
| UniProt ID | Q96B36, A0A024QZF6 |
| Cytogenetics | 19q13.33 |
| Summary | AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]). [supplied by OMIM, Mar 2008] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410168 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420655 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY410168 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 |
USD 436.00 |
|
| LY420655 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 |
USD 436.00 |
|
| PH300919 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751) |
USD 2,055.00 |
|
| PH312216 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103) |
USD 2,055.00 |
|
| TP300919 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 |
USD 823.00 |
|
| TP311995 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 |
USD 748.00 |
|
| TP312216 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China