PRAS40 (AKT1S1) (NM_001098633) Human Mass Spec Standard

CAT#: PH312216

AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103)

Product Images

Coomassie blue staining of purified AKT1S1 protein (Cat# TP312216). The protein was produced from HEK293T cells transfected with AKT1S1 cDNA clone (Cat# RC212216) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212216
• Predicted MW: 27.2 kDa
• Protein Sequence:
  Sequence Link

  >RC212216 representing NM_001098633
  Red=Cloning site Green=Tags(s)
  
  MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR
  AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL
  PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP
  SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001092103
• RefSeq Size: 1789
• RefSeq ORF: 768
• Synonyms: Lobe; PRAS40
• Locus ID: 84335
• UniProt ID: Q96B36, A0A024QZF6
• Cytogenetics: 19q13.33
• Summary: AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]). [supplied by OMIM, Mar 2008]