PRAS40 (AKT1S1) (NM_032375) Human Recombinant Protein

CAT#: TP300919

Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1

Product Images

Coomassie blue staining of purified AKT1S1 protein (Cat# TP300919). The protein was produced from HEK293T cells transfected with AKT1S1 cDNA clone (Cat# RC200919) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200919 representing NM_032375
  Red=Cloning site Green=Tags(s)
  
  MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYPAHGRGALAEAARRCLHDIALAHR
  AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL
  PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP
  SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115751
• Locus ID: 84335
• UniProt ID: Q96B36
• Cytogenetics: 19q13.33
• Refseq Size: 2344
• Refseq ORF: 768
• Synonyms: Lobe; PRAS40
• Summary: AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008]