HMGA1 (NM_145902) Human Mass Spec Standard
CAT#: PH313109
HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665909)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213109 |
Predicted MW | 10.5 kDa |
Protein Sequence |
>RC213109 representing NM_145902
Red=Cloning site Green=Tags(s) MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGR KPRGRPKKLEKEEEEGISQESSEEEQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_665909 |
RefSeq Size | 1843 |
RefSeq ORF | 288 |
Synonyms | HMG-R; HMGA1A; HMGIY |
Locus ID | 3159 |
UniProt ID | P17096, Q5T6U8 |
Cytogenetics | 6p21.31 |
Summary | 'This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016]' |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407836 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407837 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407838 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407839 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407840 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407841 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419517 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430161 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430162 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430164 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407836 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 |
USD 396.00 |
|
LY407837 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 |
USD 396.00 |
|
LY407838 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 |
USD 396.00 |
|
LY407839 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5 |
USD 396.00 |
|
LY407840 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 6 |
USD 396.00 |
|
LY407841 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 |
USD 396.00 |
|
LY419517 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 2 |
USD 396.00 |
|
LY430161 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 |
USD 396.00 |
|
LY430162 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 |
USD 396.00 |
|
LY430164 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 |
USD 396.00 |
|
PH301458 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) |
USD 2,055.00 |
|
PH302928 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906) |
USD 2,055.00 |
|
PH304972 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665910) |
USD 2,055.00 |
|
PH317302 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665911) |
USD 2,055.00 |
|
PH317358 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665912) |
USD 2,055.00 |
|
TP301458 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 2 |
USD 823.00 |
|
TP302928 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 1 |
USD 823.00 |
|
TP304972 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5 |
USD 823.00 |
|
TP313109 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 4 |
USD 748.00 |
|
TP317302 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6 |
USD 748.00 |
|
TP317358 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 7 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review