GPLD1 (NM_177483) Human Recombinant Protein

CAT#: TP323455

Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2

Product Images

Coomassie blue staining of purified GPLD1 protein (Cat# TP323455). The protein was produced from HEK293T cells transfected with GPLD1 cDNA clone (Cat# RC223455) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223455 representing NM_177483
  Red=Cloning site Green=Tags(s)
  
  MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF
  YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG
  FLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_803436
• Locus ID: 2822
• UniProt ID: P80108
• Cytogenetics: 6p22.3
• Refseq Size: 1096
• Refseq ORF: 528
• Synonyms: GPIPLD; GPIPLDM; MGC22590; PIGPLD; PIGPLD1
• Summary: Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis